LETMD1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FPRQLLIRHFWTPKQQTDFLDIYHAFRKQSHPEIISYLEKVIPLISDAGLRWRLTDLCTKIQRG |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
LETMD1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for LETMD1 Antibody - BSA Free
Background
LETMD1, also known as LETM1 domain-containing protein 1, is a protein with 7 isoforms ranging from 99 amino acid and 11 kDa to 373 amino acid and 43 kDa; localizes in mitochondrion outer membrane; commonly found in kidney, liver, skeletal muscle, heart and brain; has a potential role in tumor genesis, which may result from negative regulation of the p53 tumor suppressor gene. Studies are being performed in relation to this protein and wolf-Hirsch horn syndrome, cervical cancer, cervicitis, breast cancer, leukemia/lymphoma, polyposis, pancreatic cancer, obesity, pancreatitis, leukemia, and carcinoma. This protein has been shown to interact with REEP5 protein.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu, Mu
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P, KD, WB
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: ELISA, Func, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
Publications for LETMD1 Antibody (NBP2-57582) (0)
There are no publications for LETMD1 Antibody (NBP2-57582).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for LETMD1 Antibody (NBP2-57582) (0)
There are no reviews for LETMD1 Antibody (NBP2-57582).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for LETMD1 Antibody (NBP2-57582) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional LETMD1 Products
Research Areas for LETMD1 Antibody (NBP2-57582)
Find related products by research area.
|
Blogs on LETMD1