Legumain/Asparaginyl Endopeptidase Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Legumain/Asparaginyl Endopeptidase Antibody [NBP1-87793] - Staining of human cell line RT4 shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Legumain/Asparaginyl Endopeptidase Antibody [NBP1-87793] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Legumain/Asparaginyl Endopeptidase Antibody [NBP1-87793] - Staining of human tonsil shows strong granular cytoplasmic positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: Legumain/Asparaginyl Endopeptidase Antibody [NBP1-87793] - Staining of human gastrointestinal shows strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Legumain/Asparaginyl Endopeptidase Antibody [NBP1-87793] - Staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Legumain/Asparaginyl Endopeptidase Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Legumain/Asparaginyl Endopeptidase Antibody - BSA Free (NBP1-87793) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QGMKRKASSPVPLPPVTHLDLTPSPDVPLTIMKRKLMNTNDLEESRQLTEEIQRHLDARHLIEKSVRKIVSLLAASEAEVEQLLSERAPLTGHSCYPEALLHFRTHCFNWHSPTYEYALRHLYVLVNLCEKPYPLHRIKLSMDHVCLGHY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LGMN
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  Legumain/Asparaginyl Endopeptidase Protein (NBP1-87793PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Legumain/Asparaginyl Endopeptidase Antibody - BSA Free

• AEP
• Asparaginyl Endopeptidase
• cysteine protease 1
• Legumain
• LGMN
• LGMN1
• Protease, cysteine 1
• protease, cysteine, 1 (legumain)
• PRSC1EC 3.4.22.34

Background

Legumain encodes a cysteine protease that has a strict specificity for hydrolysis of asparaginyl bonds. This enzyme may be involved in the processing of bacterial peptides and endogenous proteins for MHC class II presentation in the lysosomal/endosomal systems. Enzyme activation is triggered by acidic pH and appears to be autocatalytic. Protein expression occurs after monocytes differentiate into dendritic cells. A fully mature, active enzyme is produced following lipopolysaccharide expression in mature dendritic cells. Overexpression of this gene may be associated with the majority of solid tumor types. This gene has a pseudogene on chromosome 13. Several alternatively spliced transcript variants have been described, but the biological validity of only two has been determined. These two variants encode the same isoform. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Legumain/Asparaginyl Endopeptidase Antibody (NBP1-87793)(1)

Publication using NBP1-87793

• Olson E, Plaut J, Barnhill S et al. Enzyme-Instructed Formation of beta-Sheet-Rich Nanoplatelets for Label-Free Protease Sensing ACS Applied Nano Materials 2021-07-23

Bioinformatics

• Gene Symbol: LGMN