Legumain/Asparaginyl Endopeptidase Antibody

Images

 
Immunohistochemistry: Legumain/Asparaginyl Endopeptidase Antibody [NBP1-87793] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Legumain/Asparaginyl Endopeptidase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QGMKRKASSPVPLPPVTHLDLTPSPDVPLTIMKRKLMNTNDLEESRQLTEEIQRHLDARHLIEKSVRKIVSLLAASEAEVEQLLSERAPLTGHSCYPEALLHFRTHCFNWHSPTYEYALRHLYVLVNLCEKPYPLHRIKLSMDHVCLGHY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LGMN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Legumain/Asparaginyl Endopeptidase Protein (NBP1-87793PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Legumain/Asparaginyl Endopeptidase Antibody

  • AEP
  • Asparaginyl Endopeptidase
  • cysteine protease 1
  • Legumain
  • LGMN
  • LGMN1
  • Protease, cysteine 1
  • protease, cysteine, 1 (legumain)
  • PRSC1EC 3.4.22.34

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF953
Species: Hu
Applications: WB, Simple Western, IHC, IP
AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-59448
Species: Hu
Applications: WB
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-57614
Species: Hu
Applications: ICC/IF
AF1286
Species: Hu
Applications: WB, Simple Western, IHC, IP
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
H00000518-R01
Species: Hu
AF2340
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
AF3749
Species: Hu
Applications: WB, IHC
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-87793
Species: Hu
Applications: IHC, IHC-P

Publications for Legumain/Asparaginyl Endopeptidase Antibody (NBP1-87793) (0)

There are no publications for Legumain/Asparaginyl Endopeptidase Antibody (NBP1-87793).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Legumain/Asparaginyl Endopeptidase Antibody (NBP1-87793) (0)

There are no reviews for Legumain/Asparaginyl Endopeptidase Antibody (NBP1-87793). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Legumain/Asparaginyl Endopeptidase Antibody (NBP1-87793) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Legumain/Asparaginyl Endopeptidase Products

Bioinformatics Tool for Legumain/Asparaginyl Endopeptidase Antibody (NBP1-87793)

Discover related pathways, diseases and genes to Legumain/Asparaginyl Endopeptidase Antibody (NBP1-87793). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Legumain/Asparaginyl Endopeptidase Antibody (NBP1-87793)

Discover more about diseases related to Legumain/Asparaginyl Endopeptidase Antibody (NBP1-87793).
 

Pathways for Legumain/Asparaginyl Endopeptidase Antibody (NBP1-87793)

View related products by pathway.

Research Areas for Legumain/Asparaginyl Endopeptidase Antibody (NBP1-87793)

Find related products by research area.

Blogs on Legumain/Asparaginyl Endopeptidase

There are no specific blogs for Legumain/Asparaginyl Endopeptidase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Legumain/Asparaginyl Endopeptidase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LGMN
Entrez