LDLR Recombinant Protein Antigen

Images

 
There are currently no images for LDLR Recombinant Protein Antigen (NBP1-87476PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

LDLR Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LDLR.

Source: E. coli

Amino Acid Sequence: RTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTEAEAAVATQETSTVRLKVSSTAVRTQHTTTRPVPDTSRLPGATPGLTTVEIVTMSHQALGDVAGRGNEKKPSSV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LDLR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87476.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LDLR Recombinant Protein Antigen

  • FH
  • FHC
  • LDL R
  • LDL receptor
  • LDLCQ2
  • LDLR
  • low density lipoprotein receptor
  • low-density lipoprotein receptor class A domain-containing protein 3
  • low-density lipoprotein receptor

Background

The low density lipoprotein (LDL) receptor system coordinates the metabolism of cholesterol, an essential component of the plasma membrane of all mammalian cells. Study of this system has led to an enhanced understanding of the cellular basis of cholesterol homeostasis. It has also brought into focus an important mechanism of metabolic regulation--the process of receptor-mediated endocytosis. Data suggest that the juxtamembranous region of the cytoplasmic domain participates in protein:protein interactions that allow the low density lipoprotein receptor to cluster in coated pits. It has been shown that the family of LDL receptors may serve as viral receptors. Endocytosis of the Flaviviridae viruses, hepatitis C virus, GB virus C/hepatitis G virus, and bovine viral diarrheal virus (BVDV) were shown to be mediated by LDL receptors on cultured cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-527
Species: Hu, Mu, Rt
Applications: IP, WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, WB
MPC900
Species: Mu
Applications: ELISA
NBP2-66888
Species: Hu, Mu, Rt
Applications:  IHC-P, IP, Simple Western, WB
NB100-64808
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, WB
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP2-37477
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-74543
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP2-79854
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP1-82820
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP3-14454
Species: Hu
Applications: IHC,  IHC-P
NBP2-52979
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF2258
Species: Mu
Applications: IHC, WB
NB600-582
Species: Ca, Ch, SyHa, Ha, Hu, Pm, Mu, Rt
Applications: IHC-Fr, KO, Simple Western, WB
236-EG
Species: Hu
Applications: BA
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P

Publications for LDLR Recombinant Protein Antigen (NBP1-87476PEP) (0)

There are no publications for LDLR Recombinant Protein Antigen (NBP1-87476PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LDLR Recombinant Protein Antigen (NBP1-87476PEP) (0)

There are no reviews for LDLR Recombinant Protein Antigen (NBP1-87476PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for LDLR Recombinant Protein Antigen (NBP1-87476PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LDLR Products

Research Areas for LDLR Recombinant Protein Antigen (NBP1-87476PEP)

Find related products by research area.

Blogs on LDLR

There are no specific blogs for LDLR, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our LDLR Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LDLR