LDHD Antibody

Images

 
Western Blot: LDHD Antibody [NBP1-56558] - Human Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LDHD Antibody Summary

Immunogen
Synthetic peptides corresponding to LDHD(lactate dehydrogenase D) The peptide sequence was selected from the middle region of LDHD. Peptide sequence LLVNPDDAEELGRVKAFAEQLGRRALALHGTCTGEHGIGMGKRQLLQEEV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LDHD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against LDHD and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LDHD Antibody

  • D-lactate dehydrogenase
  • EC 1.1.2.4
  • lactate dehydrogenase DDLD
  • MGC57726
  • probable D-lactate dehydrogenase, mitochondrial

Background

The exact functions of LDHD remain unknown.The protein encoded by this gene belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. The similar protein in yeast has both D-lactate and D-glycerate dehydrogenase activities. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-182
Species: Hu, Mu, Rt, Ca, Kg, Pm, Ze
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, RNAi, ICC
NBP1-88361
Species: Hu
Applications: WB, Flow, ICC/IF
NB100-74510
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-85871
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89559
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-55298
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-48336
Species: Hu, Mu, Bv
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2574
Species: Hu
Applications: CyTOF-ready, ICFlow
NB100-56503
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, Flow-CS, Flow-IC
NBP1-84304
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC-Fr, IF
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for LDHD Antibody (NBP1-56558) (0)

There are no publications for LDHD Antibody (NBP1-56558).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LDHD Antibody (NBP1-56558) (0)

There are no reviews for LDHD Antibody (NBP1-56558). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LDHD Antibody (NBP1-56558) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LDHD Products

Bioinformatics Tool for LDHD Antibody (NBP1-56558)

Discover related pathways, diseases and genes to LDHD Antibody (NBP1-56558). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LDHD Antibody (NBP1-56558)

Discover more about diseases related to LDHD Antibody (NBP1-56558).
 

Pathways for LDHD Antibody (NBP1-56558)

View related products by pathway.

Blogs on LDHD

There are no specific blogs for LDHD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LDHD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LDHD
Uniprot