LDB3 Antibody


Immunohistochemistry-Paraffin: LDB3 Antibody [NBP2-14190] - Staining of human skeletal muscle shows high expression.
Immunohistochemistry: LDB3 Antibody [NBP2-14190] - Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: LDB3 Antibody [NBP2-14190] - Staining of human prostate shows low expression as expected.
Immunohistochemistry-Paraffin: LDB3 Antibody [NBP2-14190] - Staining in human skeletal muscle and prostate tissues using anti-LDB3 antibody. Corresponding LDB3 RNA-seq data are presented for the same tissues.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

LDB3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PIGLYSAETLREMAQMYQMSLRGKASGVGLPGGSLPIKDLAVDSASPVYQ AVIKSQNKPEDEADEWARRSSNLQS
Specificity of human LDB3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LDB3 Protein (NBP2-14190PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for LDB3 Antibody

  • CMD1C
  • KIAA01613
  • KIAA0613FLJ35865
  • LDB3Z1
  • LDB3Z4
  • LIM domain binding 3
  • LIM domain-binding protein 3
  • PDLIM6
  • PDZ and LIM domain 6
  • Protein cypher
  • Z-band alternatively spliced PDZ-motif protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
Species: Hu
Applications: WB, ELISA
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for LDB3 Antibody (NBP2-14190) (0)

There are no publications for LDB3 Antibody (NBP2-14190).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LDB3 Antibody (NBP2-14190) (0)

There are no reviews for LDB3 Antibody (NBP2-14190). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LDB3 Antibody (NBP2-14190) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional LDB3 Products

Bioinformatics Tool for LDB3 Antibody (NBP2-14190)

Discover related pathways, diseases and genes to LDB3 Antibody (NBP2-14190). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LDB3 Antibody (NBP2-14190)

Discover more about diseases related to LDB3 Antibody (NBP2-14190).

Pathways for LDB3 Antibody (NBP2-14190)

View related products by pathway.

PTMs for LDB3 Antibody (NBP2-14190)

Learn more about PTMs related to LDB3 Antibody (NBP2-14190).

Blogs on LDB3

There are no specific blogs for LDB3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LDB3 Antibody and receive a gift card or discount.


Gene Symbol LDB3