LCMT2 Antibody

Images

 
Western Blot: LCMT2 Antibody [NBP2-56384] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: LCMT2 Antibody [NBP2-56384] - Staining of human cell line HeLa shows localization to nucleoplasm & vesicles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LCMT2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TLVFPSSEAFPRVNPASPSGVFPASVVSSEGQVPNLKRYGHASVFLSPDVILSAGGFGEQEGRHCRVSQFHLLSRDCDSEWKGSQIGSCGTGVQWDGR
Specificity
Specificity of human LCMT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LCMT2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LCMT2 Recombinant Protein Antigen (NBP2-56384PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for LCMT2 Antibody

  • EC 2.1.1.-
  • FLJ51321
  • KIAA0547tRNA-Wybutosine-synthesizing protein 4
  • leucine carboxyl methyltransferase 2
  • MGC9534
  • p21WAF1/CIP1 promoter-interacting protein
  • PPM2
  • tRNA wybutosine-synthesizing protein 4 homolog
  • tRNA yW-synthesizing protein 4 homolog
  • TYW4tRNA-yW synthesizing protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20772
Species: Hu
Applications: WB, ICC/IF
NBP1-83633
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88492
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00002678-M01
Species: Hu, Mu, Ye
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-67150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-81427
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
AF3894
Species: Mu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ICC
NBP2-66926
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP1-82909
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP3-04883
Species: Hu, Mu, Rt
Applications: WB
NBP1-50579
Species: Hu, Mu, Rt, Bt, Bv, Ca, Eq, Ha, Pm, Pm, Rb, Sh, Xp, Ze
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-00923
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC, IHC-P
NBP2-98675
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-56384
Species: Hu
Applications: WB, ICC/IF

Publications for LCMT2 Antibody (NBP2-56384) (0)

There are no publications for LCMT2 Antibody (NBP2-56384).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LCMT2 Antibody (NBP2-56384) (0)

There are no reviews for LCMT2 Antibody (NBP2-56384). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LCMT2 Antibody (NBP2-56384) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LCMT2 Products

Bioinformatics Tool for LCMT2 Antibody (NBP2-56384)

Discover related pathways, diseases and genes to LCMT2 Antibody (NBP2-56384). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LCMT2 Antibody (NBP2-56384)

Discover more about diseases related to LCMT2 Antibody (NBP2-56384).

Blogs on LCMT2

There are no specific blogs for LCMT2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LCMT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LCMT2