PP4/PPP4C Antibody - BSA Free

Immunohistochemistry-Paraffin: PP4/PPP4C Antibody [NBP2-13802] - Staining in human testis and skeletal muscle tissues using anti-PPP4C antibody. Corresponding PPP4C RNA-seq data are presented for the same tissues.

Western Blot: PP4/PPP4C Antibody [NBP2-13802] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4

Immunocytochemistry/Immunofluorescence: PP4/PPP4C Antibody [NBP2-13802] - Staining of human cell line U-2 OS shows localization to nucleus, plasma membrane & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: PP4/PPP4C Antibody [NBP2-13802] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: PP4/PPP4C Antibody [NBP2-13802] - Staining of human skeletal muscle shows low expression as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PP4/PPP4C Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: MAEISDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCG
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPP4C
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  PP4/PPP4C Recombinant Protein Antigen (NBP2-13802PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PP4/PPP4C Antibody - BSA Free

• EC 3.1.3.16
• PP4
• PP4C
• PP4protein phosphatase X, catalytic subunit
• PPH3
• PPP4C
• PPX
• PP-X
• PPXPPH3
• protein phosphatase 4 (formerly X), catalytic subunit
• protein phosphatase 4, catalytic subunit
• Protein phosphatase X

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPP4C