LC3C Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: LC3C Antibody [NBP2-57604] - Staining of human cell line RH-30 shows localization to cytoplasmic bodies. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LC3C Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TKFLVPQELTMTQFLSIIRSRMVLRATEAF
Specificity
Specificity of human LC3C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAP1LC3C
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for LC3C Antibody

  • ATG8J
  • Autophagy-related protein LC3 C
  • Autophagy-related ubiquitin-like modifier LC3 C
  • LC3C
  • LC3-like protein 2
  • MAP1 light chain 3-like protein 2
  • MAP1 light chain 3-like protein 3
  • MAP1A/MAP1B LC3 C
  • microtubule-associated protein 1 light chain 3 gammaMAP1A/MAP1B light chain 3 C
  • microtubule-associated proteins 1A/1B light chain 3C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
NB100-2220
Species: Hu, Mu, Rt, Po, Av, Ba, Bv, Ca, Ch, SyHa, GP, Ha, In, Mk, Pm, Rb, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, ChIP, KO
MAB9035
Species: Hu, Mu, Rt
Applications: WB
NBP1-55202
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB, IHC, IHC-P
NBP2-22106
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-01083
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB6608
Species: Hu, Mu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICC, ICFlow
NBP2-24709
Species: Hu, Mu, Rt
Applications: WB, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-19499
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Fi, Pm, Xp, Ze
Applications: WB, Simple Western, EM, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, PLA, RIA, KO
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00064112-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-68927
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq
Applications: WB
NBP2-15501
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP

Publications for LC3C Antibody (NBP2-57604) (0)

There are no publications for LC3C Antibody (NBP2-57604).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LC3C Antibody (NBP2-57604) (0)

There are no reviews for LC3C Antibody (NBP2-57604). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LC3C Antibody (NBP2-57604) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LC3C Products

Bioinformatics Tool for LC3C Antibody (NBP2-57604)

Discover related pathways, diseases and genes to LC3C Antibody (NBP2-57604). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LC3C Antibody (NBP2-57604)

Discover more about diseases related to LC3C Antibody (NBP2-57604).
 

Pathways for LC3C Antibody (NBP2-57604)

View related products by pathway.

PTMs for LC3C Antibody (NBP2-57604)

Learn more about PTMs related to LC3C Antibody (NBP2-57604).
 

Research Areas for LC3C Antibody (NBP2-57604)

Find related products by research area.

Blogs on LC3C.


  Read full blog post.

Analyzing LC3 in Western blot
Microtubule-associated protein light chain 3 (LC3) is considered one of the definitive markers of autophagy, and its use is widespread in labs throughout the world. Despite its popularity, there are several considerations when employing LC3 antibodies...  Read full blog post.

Marking the Autophagosome: the LC3 Antibody
MAP1LC3 (shortened to LC3 in our antibody catalog) is one of four mammalian homologues of autophagy-related protein 8 (Atg8). It has been identified as a light chain subunit of the microtubule-associated proteins MAP1A/MAP1B. A modified form of LC3, L...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LC3C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAP1LC3C