LATS1 Antibody

Images

 
Western Blot: LATS1 Antibody [NBP1-86860] - Analysis in human cell line HELA.
Immunohistochemistry-Paraffin: LATS1 Antibody [NBP1-86860] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Reactivity Hu, Rt, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LATS1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PSWEPNSQTKRYSGNMEYVISRISPVPPGAWQEGYPPPPLNTSPMNPPNQGQRGISSVPVGRQPIIMQSSSKFNFPSGRP
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LATS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
WB reported in scientific literature (PMID: 29317530). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LATS1 Protein (NBP1-86860PEP)
Publications
Read Publication using
NBP1-86860 in the following applications:

  • WB
    1 publication

Reactivity Notes

Rat reactivity reported in the scientific literature (PMID: 29317530).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LATS1 Antibody

  • EC 2.7.11
  • h-warts
  • Large tumor suppressor homolog 1
  • LATS (large tumor suppressor, Drosophila) homolog 1
  • LATS, large tumor suppressor, homolog 1 (Drosophila)
  • serine/threonine-protein kinase LATS1
  • WARTS protein kinase
  • WARTSEC 2.7.11.1
  • wts

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-58358
Species: Ca, Dr, Hu, Mu, Rt, Ze
Applications: ChIP, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
NBP1-81763
Species: Hu
Applications: IHC, IHC-P, WB
H00060485-M02
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
MAB7940
Species: Hu
Applications: IHC, WB
NBP3-03913
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-48017
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
H00006789-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, PLA, WB
352-MS/CF
Species: Hu
Applications: BA, BA
NBP1-87833
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-61873
Species: Hu
Applications: ELISA, Flow, WB
H00011329-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-60081
Species: Hu
Applications: WB
NBP2-02715
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB110-58359
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, PLA, Simple Western, WB
NBP2-32569
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-03644
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-87757
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB

Publications for LATS1 Antibody (NBP1-86860)(1)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Rat
(1)
All Species

Reviews for LATS1 Antibody (NBP1-86860) (0)

There are no reviews for LATS1 Antibody (NBP1-86860). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LATS1 Antibody (NBP1-86860) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LATS1 Products

Bioinformatics Tool for LATS1 Antibody (NBP1-86860)

Discover related pathways, diseases and genes to LATS1 Antibody (NBP1-86860). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LATS1 Antibody (NBP1-86860)

Discover more about diseases related to LATS1 Antibody (NBP1-86860).
 

Pathways for LATS1 Antibody (NBP1-86860)

View related products by pathway.

PTMs for LATS1 Antibody (NBP1-86860)

Learn more about PTMs related to LATS1 Antibody (NBP1-86860).
 

Research Areas for LATS1 Antibody (NBP1-86860)

Find related products by research area.

Blogs on LATS1.

TAZ Antibody: The Devil is in the Details
WW domain-containing transcription regulator protein 1 also known as WWTR1 and TAZ, is a 44KDa protein that acts as a downstream regulatory target in the Hippo signaling pathway. This protein undergoes post-translational modification and becomes phosp...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LATS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LATS1