Latent TGF-beta bp1 Antibody

Images

 
Western Blot: LTBP1 Antibody [NBP1-79806] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Latent TGF-beta bp1 Antibody Summary

Immunogen
Synthetic peptide directed towards the C terminal of human LTBP1The immunogen for this antibody is LTBP1. Peptide sequence NVCANGDCSNLEGSYMCSCHKGYTRTPDHKHCRDIDECQQGNLCVNGQCK.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LTBP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against LTBP1 and was validated on Western blot.
Theoretical MW
154 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Latent TGF-beta bp1 Antibody

  • Latent TGFbeta bp1
  • Latent TGF-beta bp1
  • latent transforming growth factor beta binding protein 1
  • latent-transforming growth factor beta-binding protein 1
  • LTBP1
  • LTBP-1
  • MGC163161
  • TGF-beta1-BP-1
  • Transforming growth factor beta-1-binding protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-57788
Species: Hu
Applications: ICC/IF
NBP2-43671
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-8146
Species: Hu, Po, Bv, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM
H00000053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-46179
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00055835-M02
Species: Hu
Applications: WB, ELISA, IP
NBP1-86658
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu, Bv, Ca, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
302-B2/CF
Species: Hu
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
MAB9181
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready
NBP1-79806
Species: Hu
Applications: WB

Publications for Latent TGF-beta bp1 Antibody (NBP1-79806) (0)

There are no publications for Latent TGF-beta bp1 Antibody (NBP1-79806).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Latent TGF-beta bp1 Antibody (NBP1-79806) (0)

There are no reviews for Latent TGF-beta bp1 Antibody (NBP1-79806). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Latent TGF-beta bp1 Antibody (NBP1-79806) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Latent TGF-beta bp1 Antibody (NBP1-79806)

Discover related pathways, diseases and genes to Latent TGF-beta bp1 Antibody (NBP1-79806). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Latent TGF-beta bp1 Antibody (NBP1-79806)

Discover more about diseases related to Latent TGF-beta bp1 Antibody (NBP1-79806).
 

Pathways for Latent TGF-beta bp1 Antibody (NBP1-79806)

View related products by pathway.

PTMs for Latent TGF-beta bp1 Antibody (NBP1-79806)

Learn more about PTMs related to Latent TGF-beta bp1 Antibody (NBP1-79806).
 

Research Areas for Latent TGF-beta bp1 Antibody (NBP1-79806)

Find related products by research area.

Blogs on Latent TGF-beta bp1

There are no specific blogs for Latent TGF-beta bp1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Latent TGF-beta bp1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LTBP1
Entrez
Uniprot