Latent TGF-beta bp1 Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
Synthetic peptide directed towards the C terminal of human LTBP1The immunogen for this antibody is LTBP1. Peptide sequence NVCANGDCSNLEGSYMCSCHKGYTRTPDHKHCRDIDECQQGNLCVNGQCK. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
LTBP1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
154 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Latent TGF-beta bp1 Antibody - BSA Free
Background
LTBP1, also known as latent-transforming growth factor beta-binding protein 1, consists of five isoforms of sizes 186.8 kDa, 152.9 kDa, 147.2 kDa, 186.9 kDa, and 153 kDa and is involved in directing and regulating the activity of TGFB1. Current research is being conducted on diseases and disorders such as cataracts, fibrosis, geleophysic dysplasia, macular degeneration, aortic aneurysm, malignant glioma, hepatitis, vaginitis, scleroderma, and nephropathy. The protein is involved in extracellular matrix organization, mitochondrial apoptosis, TGF-beta signaling, and GSK3 signaling pathways, where it interacts with FN1, FBN2, TGFB1, ITGB5, and ATN1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Hu
Applications: WB
Species: Mu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Rt
Applications: ELISA, WB
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Bv, Fe, Hu, Rb
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, WB
Species: Hu
Applications: WB
Publications for Latent TGF-beta bp1 Antibody (NBP1-79806) (0)
There are no publications for Latent TGF-beta bp1 Antibody (NBP1-79806).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Latent TGF-beta bp1 Antibody (NBP1-79806) (0)
There are no reviews for Latent TGF-beta bp1 Antibody (NBP1-79806).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Latent TGF-beta bp1 Antibody (NBP1-79806) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Latent TGF-beta bp1 Products
Research Areas for Latent TGF-beta bp1 Antibody (NBP1-79806)
Find related products by research area.
|
Blogs on Latent TGF-beta bp1