LAR/PTPRF Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit LAR/PTPRF Antibody - BSA Free (NBP1-81325) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: WHPPKELPGELLGYRLQYCRADEARPNTIDFGKDDQHFTVTGLHKGTTYIFRLAAKNRAGLGEEFEKEIRTPEDLPSGFPQNLHVTGLTTSTTELAWDPPVLAERNGRIISYTVVFRDINSQQE |
| Predicted Species |
Mouse (90%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PTPRF |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for LAR/PTPRF Antibody - BSA Free
Background
PTPRF, also known as Receptor-type tyrosine-protein phosphatase F, is a 213kDa 1907 amino acid protein with a shorter 212kDa 1898 isoform. PTPRF is a member of the protein tyrosine phosphatase (PTP) family and functions as a possible cell adhesion receptor. Research is being conducted on PTPRF in relation to melanoma, carcinoma, retinitis, thyroid carcinoma, ureterocele, lung cancer, breast cancer and obesity. PTPRF is linked to the cell adhesion and insulin signaling pathways where it interacts with CAV1, PRPF40A, SKIL, ZNF512B and JUP.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu
Applications: IHC, IHC-P
Species: Ch, Mu
Applications: ELISA, IHC, Single-Cell Western, WB
Species: Hu, Rt
Applications: WB
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
Species: Hu
Applications: ICC/IF, WB
Species: Mu, Rt
Applications: Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
Publications for LAR/PTPRF Antibody (NBP1-81325) (0)
There are no publications for LAR/PTPRF Antibody (NBP1-81325).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for LAR/PTPRF Antibody (NBP1-81325) (0)
There are no reviews for LAR/PTPRF Antibody (NBP1-81325).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for LAR/PTPRF Antibody (NBP1-81325) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional LAR/PTPRF Products
Research Areas for LAR/PTPRF Antibody (NBP1-81325)
Find related products by research area.
|
Blogs on LAR/PTPRF