LAP3 Antibody

Images

 
Independent Antibodies: Western Blot: LAP3 Antibody [NBP1-82848] - Analysis using Anti-LAP3 antibody NBP1-82848 (A) shows similar pattern to independent antibody NBP1-82847 (B).
Immunohistochemistry-Paraffin: LAP3 Antibody [NBP1-82848] - Staining of human kidney.
Western Blot: LAP3 Antibody [NBP1-82848] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: LAP3 Antibody [NBP1-82848] - Staining of human lymph node shows high expression.
Immunohistochemistry-Paraffin: LAP3 Antibody [NBP1-82848] - Staining of human skeletal muscle shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: LAP3 Antibody [NBP1-82848] - Staining in human lymph node and skeletal muscle tissues using anti-LAP3 antibody. Corresponding LAP3 RNA-seq data are presented ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: LAP3 Antibody [NBP1-82848] - Staining of human kidney, lymph node, skeletal muscle and testis using Anti-LAP3 antibody NBP1-82848 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: LAP3 Antibody [NBP1-82848] - Staining of human testis.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LAP3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QENWHEGKENIRAAVAAGCRQIQDLELSSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKKKMAVSAKLYGSGDQEAWQKGVLFASGQ
Specificity
Specificity of human, mouse, rat LAP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LAP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control
LAP3 Knockout A549 Cell Lysate
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LAP3 Antibody

  • EC 3.4.11
  • EC 3.4.11.5
  • LAP
  • LAPEPEC 3.4.11.1
  • leucine aminopeptidase 3Prolyl aminopeptidase
  • Leucyl aminopeptidase
  • PEPScytosol aminopeptidase
  • Peptidase SLAP-3
  • Proline aminopeptidase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6386
Species: Hu
Applications: WB, IP
AF2335
Species: Mu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ICC
H00002678-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-89133
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6240
Species: Hu
Applications: WB, ELISA, IHC
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85871
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89559
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NB110-3638
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89134
Species: Hu
Applications: IHC, IHC-P
NBP2-32263
Species: Hu, Mu
Applications: WB, IHC, IP
NBP1-56928
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB, IHC, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-30375
Species: Hu
Applications: IHC, IHC-P
NBP1-82848
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for LAP3 Antibody (NBP1-82848) (0)

There are no publications for LAP3 Antibody (NBP1-82848).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LAP3 Antibody (NBP1-82848) (0)

There are no reviews for LAP3 Antibody (NBP1-82848). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LAP3 Antibody (NBP1-82848) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LAP3 Products

Bioinformatics Tool for LAP3 Antibody (NBP1-82848)

Discover related pathways, diseases and genes to LAP3 Antibody (NBP1-82848). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LAP3 Antibody (NBP1-82848)

Discover more about diseases related to LAP3 Antibody (NBP1-82848).
 

Pathways for LAP3 Antibody (NBP1-82848)

View related products by pathway.

PTMs for LAP3 Antibody (NBP1-82848)

Learn more about PTMs related to LAP3 Antibody (NBP1-82848).

Blogs on LAP3

There are no specific blogs for LAP3, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LAP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LAP3