Laminin S/Laminin beta 2 Antibody (CL2979)

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Laminin S/Laminin beta 2 Antibody (CL2979) [NBP2-42387] - Staining in human heart muscle and tonsil tissues. Corresponding LAMB2 RNA-seq data are presented ...read more
Western Blot: Laminin S/Laminin beta 2 Antibody (CL2979) [NBP2-42387] - Analysis of purified human recombinant Laminin-421, Laminin-521, Laminin-332 and Laminin-111.
Western Blot: Laminin S/Laminin beta 2 Antibody (CL2979) [NBP2-42387] - Analysis in human lung tissue.
Immunohistochemistry-Paraffin: Laminin S/Laminin beta 2 Antibody (CL2979) [NBP2-42387] - Staining of human heart muscle shows moderate membranous positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: Laminin S/Laminin beta 2 Antibody (CL2979) [NBP2-42387] - Staining of human kidney shows moderate membranous positivity in basement membrane of cells in glomeruli.
Immunohistochemistry-Paraffin: Laminin S/Laminin beta 2 Antibody (CL2979) [NBP2-42387] - Staining of human endometrium shows moderate positivity in basement membrane of glandular cells.
Immunohistochemistry-Paraffin: Laminin S/Laminin beta 2 Antibody (CL2979) [NBP2-42387] - Staining of human tonsil shows no positivity in lymphoid cells as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clone
CL2979
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Laminin S/Laminin beta 2 Antibody (CL2979) Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DLTDVQDENFNANHALSGLERDRLALNLTLRQLDQHLDLLKHSNFLGAYDSIRHAHSQSAEAERRANTSALAVPSPVSNSASARHRTEALMDAQKEDFNSKHMANQRALGKLSAHTHTLSLTDINELVCGAPG
Epitope
NANHALSGLERDRLA
Isotype
IgG2a
Clonality
Monoclonal
Host
Mouse
Gene
LAMB2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000-1:10000
  • Western Blot 1 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Expected to cross react based on sequence identity: Rat (82%), Mouse (83%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Laminin S/Laminin beta 2 Antibody (CL2979)

  • LAMB2
  • Laminin B1s chain
  • Laminin beta 2
  • Laminin S
  • laminin subunit beta-2
  • laminin, beta 2 (laminin S)
  • Laminin-11 subunit beta
  • Laminin-14 subunit beta
  • Laminin-15 subunit beta
  • Laminin-3 subunit beta
  • Laminin-4 subunit beta
  • Laminin-7 subunit beta
  • LAMSLaminin-9 subunit beta
  • S-LAM beta
  • S-laminin subunit beta

Background

The Laminins comprise a growing family of disulfide-linked heterotrimers consisting of three genetically distinct polypeptide chains, designated alpha, beta and gamma. A major component of the basal lamina, Laminins play a crucial role in providing a scaffolding upon which tissues are assembled and which serves as a physical barrier separating specialized tissues. During embryogenesis and early development, cells migrate along basement membranes, which are required for the polarization of cells. The beta-2 laminin chain plays a role in melanoma spread, promoting tumor migration along the abluminal surface of vessel, a phenomenon which has been termed extra-vascular migratory metastasis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3159
Species: Mu
Applications: IHC
NBP2-75624
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB110-60011
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
AF6240
Species: Hu
Applications: ELISA, IHC, WB
NBP1-87345
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87343
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP2-24763
Species: Hu, Pm
Applications: IHC, IHC-P, WB
NBP3-04411
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24614
Species: Hu, Mu, Ma-Op, Pm, Rt
Applications: WB
NBP2-48909
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO
NBP2-93574
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF4090
Species: Hu
Applications: IHC, IP, Neut, WB
H00000081-M01
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF1265
Species: Mu
Applications: IP, Neut, WB
NBP1-92275
Species: Hu
Applications: IHC, IHC-P
AF6868
Species: Hu
Applications: IHC, KO, WB
NBP3-10064
Species: Hu
Applications: WB
MAB4077
Species: Hu
Applications: IHC, WB
550-AG/CF
Species: Rt
Applications: BA, BA

Publications for Laminin S/Laminin beta 2 Antibody (NBP2-42387) (0)

There are no publications for Laminin S/Laminin beta 2 Antibody (NBP2-42387).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Laminin S/Laminin beta 2 Antibody (NBP2-42387) (0)

There are no reviews for Laminin S/Laminin beta 2 Antibody (NBP2-42387). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Laminin S/Laminin beta 2 Antibody (NBP2-42387) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Laminin S/Laminin beta 2 Products

Bioinformatics Tool for Laminin S/Laminin beta 2 Antibody (NBP2-42387)

Discover related pathways, diseases and genes to Laminin S/Laminin beta 2 Antibody (NBP2-42387). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Laminin S/Laminin beta 2 Antibody (NBP2-42387)

Discover more about diseases related to Laminin S/Laminin beta 2 Antibody (NBP2-42387).
 

Pathways for Laminin S/Laminin beta 2 Antibody (NBP2-42387)

View related products by pathway.

PTMs for Laminin S/Laminin beta 2 Antibody (NBP2-42387)

Learn more about PTMs related to Laminin S/Laminin beta 2 Antibody (NBP2-42387).

Blogs on Laminin S/Laminin beta 2

There are no specific blogs for Laminin S/Laminin beta 2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Laminin S/Laminin beta 2 Antibody (CL2979) and receive a gift card or discount.

Bioinformatics

Gene Symbol LAMB2
Uniprot