Laminin gamma 1 Recombinant Protein Antigen

Images

 
There are currently no images for Laminin gamma 1 Protein (NBP1-87718PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Laminin gamma 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LAMC1.

Source: E. coli

Amino Acid Sequence: STKAEAERTFAEVTDLDNEVNNMLKQLQEAEKELKRKQDDADQDMMMAGMASQAAQEAEINARKAKNSVTSLLSIINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LAMC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87718.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Laminin gamma 1 Recombinant Protein Antigen

  • LAMB2Laminin-7 subunit gamma
  • LAMC1
  • Laminin B2 chain
  • Laminin B2
  • Laminin gamma 1
  • laminin subunit gamma-1
  • laminin, gamma 1 (formerly LAMB2)
  • Laminin-1 subunit gamma
  • Laminin-10 subunit gamma
  • Laminin-11 subunit gamma
  • Laminin-2 subunit gamma
  • Laminin-3 subunit gamma
  • Laminin-4 subunit gamma
  • Laminin-6 subunit gamma
  • Laminin-8 subunit gamma
  • Laminin-9 subunit gamma
  • MGC87297
  • S-LAM gamma
  • S-laminin subunit gamma

Background

Laminins are essential and abundant structural non-collagenous glycoproteins localizing to basement membranes. Basement membranes (cell-associated extracellular matrices (ECMs)) are polymers of Laminins with stabilizing Type IV Collagen networks, Nidogen and several proteoglycans. Basement membranes are found under epithelial layers, around the endothelium of blood vessels, and surrounding muscle, peripheral nerve and fat cells. Formation of basement membranes influences cell proliferation, phenotype, migration, gene expression and tissue architecture. Each Laminin is a heterotrimer of alpha, beta and gamma chain subunits that undergoes cell-secretion and incorporation into the ECM. Laminins can self-assemble, bind to other matrix macromolecules and have unique and shared cell interactions mediated by Integrins, dystroglycan and cognate Laminin receptors. The human Laminin gamma-1 gene maps to chromosome 1q31 and is ubiquitously expressed in tissues that produce basement membranes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-51558
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF3159
Species: Mu
Applications: IHC
NBP2-75624
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, mIF, WB
NB110-60011
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP2-42388
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB300-144
Species: ChHa, Hu, In, Ma, Mu, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
AF578
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
NBP2-30604
Species: Hu
Applications: IHC,  IHC-P
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF4090
Species: Hu
Applications: IHC, IP, Neut, WB
PP-H8132-00
Species: Hu
Applications: IHC, IP, WB
H00000081-M01
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
233-FB
Species: Hu
Applications: BA
NB120-6586
Species: Bv, Fe, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, KO, mIF, Simple Western, SR Microscopy, WB
AF2364
Species: Hu
Applications: IHC, WB
NBP2-47412
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-87718PEP
Species: Hu
Applications: AC

Publications for Laminin gamma 1 Protein (NBP1-87718PEP) (0)

There are no publications for Laminin gamma 1 Protein (NBP1-87718PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Laminin gamma 1 Protein (NBP1-87718PEP) (0)

There are no reviews for Laminin gamma 1 Protein (NBP1-87718PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Laminin gamma 1 Protein (NBP1-87718PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Laminin gamma 1 Products

Research Areas for Laminin gamma 1 Protein (NBP1-87718PEP)

Find related products by research area.

Blogs on Laminin gamma 1

There are no specific blogs for Laminin gamma 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Laminin gamma 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LAMC1