We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Laminin gamma 1 Antibody (M1)

Images

 
Proximity Ligation Assay: Laminin gamma 1 Antibody (M1) [H00003915-M03] - Analysis of protein-protein interactions between LAMA5 and LAMC1. HeLa cells were stained with anti-LAMA5 rabbit purified polyclonal 1:1200 and ...read more
Sandwich ELISA: Laminin gamma 1 Antibody (M1) [H00003915-M03] - Detection limit for recombinant GST tagged LAMC1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Product Discontinued
View other related Laminin gamma 1 Primary Antibodies

Order Details


    • Catalog Number
      H00003915-M03
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Laminin gamma 1 Antibody (M1) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
LAMC1 (AAH15586, 1 a.a. ~ 38 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MNKRRTSHRIWKNKLPEYMRRPKGPVTKLWRSMPAWLS
Specificity
LAMC1 - laminin, gamma 1 (formerly LAMB2)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LAMC1
Purity
Ascites
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Proximity Ligation Assay
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Ascites

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Laminin gamma 1 Antibody (M1)

  • LAMB2Laminin-7 subunit gamma
  • LAMC1
  • Laminin B2 chain
  • Laminin B2
  • Laminin gamma 1
  • laminin subunit gamma-1
  • laminin, gamma 1 (formerly LAMB2)
  • Laminin-1 subunit gamma
  • Laminin-10 subunit gamma
  • Laminin-11 subunit gamma
  • Laminin-2 subunit gamma
  • Laminin-3 subunit gamma
  • Laminin-4 subunit gamma
  • Laminin-6 subunit gamma
  • Laminin-8 subunit gamma
  • Laminin-9 subunit gamma
  • MGC87297
  • S-LAM gamma
  • S-laminin subunit gamma

Background

Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Laminins are composed of 3 non identical chains: laminin alpha, beta and gamma (formerly A, B1, and B2, respectively) and they form a cruciform structure consisting of 3 short arms, each formed by a different chain, and a long arm composed of all 3 chains. Each laminin chain is a multidomain protein encoded by a distinct gene. Several isoforms of each chain have been described. Different alpha, beta and gamma chain isomers combine to give rise to different heterotrimeric laminin isoforms which are designated by Arabic numerals in the order of their discovery, i.e. alpha1beta1gamma1 heterotrimer is laminin 1. The biological functions of the different chains and trimer molecules are largely unknown, but some of the chains have been shown to differ with respect to their tissue distribution, presumably reflecting diverse functions in vivo. This gene encodes the gamma chain isoform laminin, gamma 1. The gamma 1 chain, formerly thought to be a beta chain, contains structural domains similar to beta chains, however, lacks the short alpha region separating domains I and II. The structural organization of this gene also suggested that it had diverged considerably from the beta chain genes. Embryos of transgenic mice in which both alleles of the gamma 1 chain gene were inactivated by homologous recombination, lacked basement membranes, indicating that laminin, gamma 1 chain is necessary for laminin heterotrimer assembly. It has been inferred by analogy with the strikingly similar 3' UTR sequence in mouse laminin gamma 1 cDNA, that multiple polyadenylation sites are utilized in human to generate the 2 different sized mRNAs (5.5 and 7.5 kb) seen on Northern analysis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-51558
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF3159
Species: Mu
Applications: IHC
NBP2-75624
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, mIF, WB
NB110-60011
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP2-42388
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB300-144
Species: ChHa, Hu, In, Ma, Mu, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, WB
NBP3-47877
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IP, WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
AF578
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
NBP2-54591
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, PA
NBP2-30604
Species: Hu
Applications: IHC,  IHC-P
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF4277
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
PP-H8132-00
Species: Hu
Applications: IHC, IP, WB
H00000081-M01
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
233-FB
Species: Hu
Applications: BA
NB120-6586
Species: Bv, Fe, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, KO, mIF, Simple Western, SR Microscopy, WB
AF2364
Species: Hu
Applications: IHC, WB
NBP2-47412
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00003915-M03
Species: Hu
Applications: WB, ELISA, Func

Publications for Laminin gamma 1 Antibody (H00003915-M03) (0)

There are no publications for Laminin gamma 1 Antibody (H00003915-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Laminin gamma 1 Antibody (H00003915-M03) (0)

There are no reviews for Laminin gamma 1 Antibody (H00003915-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Laminin gamma 1 Antibody (H00003915-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Laminin gamma 1 Products

Research Areas for Laminin gamma 1 Antibody (H00003915-M03)

Find related products by research area.

Blogs on Laminin gamma 1

There are no specific blogs for Laminin gamma 1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Laminin gamma 1 Antibody (M1) and receive a gift card or discount.

Bioinformatics

Gene Symbol LAMC1
Entrez
OMIM
Uniprot