Laminin alpha 5 Antibody (2F7) - Azide and BSA Free

Western Blot: Laminin alpha 5 Antibody (2F7) [H00003911-M01] - Analysis of LAMA5 expression in transfected 293T cell line by LAMA5 monoclonal antibody (M01), clone 2F7.Lane 1: LAMA5 transfected lysate(74 KDa).Lane 2: Non-transfected lysate.

ELISA: Laminin alpha 5 Antibody (2F7) [H00003911-M01] - Detection limit for recombinant GST tagged LAMA5 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IHC
• Clone: 2F7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Laminin alpha 5 Antibody (2F7) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: LAMA5 (AAH03355.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGVSLRDKKVHWVYQLGEAGPAVLSIDEDIGEQFAAVSLDRTLQFGHMSVTVERQMIQETKGDTVAPGAEGLLNLRPDDFVFYVGGYPSTFTPPPLLRFP
• Localization: Secreted, extracellular space, extracellular matrix, basement membrane.
• Specificity: LAMA5 - laminin, alpha 5
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: LAMA5
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID: 31091437). Use in Immunohistochemistry-paraffin reported in scientific literature (PMID: 21195710).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Laminin alpha 5 Antibody (2F7) - Azide and BSA Free

• KIAA0533
• KIAA1907
• laminin alpha-5 chain
• laminin subunit alpha-5
• laminin, alpha 5
• Laminin-10 subunit alpha
• Laminin-11 subunit alpha
• Laminin-15 subunit alpha

Background

Components of the extracellular matrix exert myriad effects on tissues throughout the body. In particular, the laminins, a family of heterotrimeric extracellular glycoproteins, affect tissue development and integrity in such diverse organs as the kidney, lung, skin, and nervous system. It is thought that laminins mediate the attachment, migration, and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. Laminins function as heterotrimeric complexes of alpha, beta, and gamma chains, with each chain type representing a different subfamily of proteins. The protein encoded by this gene belongs to the alpha subfamily of laminin chains and is a major component of basement membranes. Two transcript variants encoding different isoforms have been found for this gene, but the full-length nature of one of them has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Laminin alpha 5 Antibody (H00003911-M01)(9)

Publications using H00003911-M01

• Hwee T, Helder A, Vicki C et al. Photoreceptor laminin drives differentiation of human pluripotent stem cells to photoreceptor progenitors that partially restore retina function. Mol Ther. 2023-01-05 [PMID: 36638800]
• Evans R, Flores-Borja F, Nassiri S Integrin-Mediated Macrophage Adhesion Promotes Lymphovascular Dissemination in Breast Cancer Cell Rep May 14 2019 [PMID: 31091437] (ICC/IF, Mouse, Human)
• Little GH, Noushmehr H, Baniwal SK Genome-wide Runx2 occupancy in prostate cancer cells suggests a role in regulating secretion Nucleic Acids Res. 2012-04-01 [PMID: 27490379] (WB, Human)
• Little GH, Noushmehr H, Baniwal SK Genome-wide Runx2 occupancy in prostate cancer cells suggests a role in regulating secretion Nucleic Acids Res. 2012-04-01 [PMID: 27490379] (WB, Human)
• Little GH, Noushmehr H, Baniwal SK et al. Genome-wide Runx2 occupancy in prostate cancer cells suggests a role in regulating secretion. Nucleic Acids Res. 2011 Dec 19 [PMID: 22187159]
• Little G, Noushmehr H, Baniwal S et al. Genome-wide Runx2 occupancy in prostate cancer cells suggests a role in regulating secretion. Nucleic Acids Res. 2011-12-19 [PMID: 22187159]
• Oikawa Y, Hansson J, Sasaki T et al. Melanoma cells produce multiple laminin isoforms and stronglymigrate on alpha 5 laminin(s) via several integrin receptors Exp Cell Res. 2011-05-01 [PMID: 21195710] (IHC-P, Human)
• Wu HY, Chang YH, Chang YC, Liao PC et al. Proteomics analysis of nasopharyngeal carcinoma cell secretome using a hollow fiber culture system and mass spectrometry. J Proteome Res. 2009-01-01 [PMID: 19012429] (WB, Human)
• Maynard DM, Heijnen HF, Horne MK Proteomic analysis of platelet alpha-granules using mass spectrometry. J Thromb Haemost. 2007-09-01 [PMID: 17723134] (IHC-P, Human)

Bioinformatics

• Gene Symbol: LAMA5
• Entrez:
  • 3911(Human)
• OMIM:
  • 601033(Human)