Laminin alpha 4 Antibody

Images

 
Western Blot: Laminin alpha 4 Antibody [H00003910-B02P] - Analysis of LAMA4 expression in transfected 293T cell line by LAMA4 polyclonal antibody. Lane 1: LAMA4 transfected lysate(13.2 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Laminin alpha 4 Antibody Summary

Immunogen
LAMA4 (AAH04241.1, 1 a.a. - 120 a.a.) full-length human protein. MALSSAWRSVLPLWLLWSAACSRAASGDDNAFPFDIEGSSAVGRQDPPETSEPRVALGRLPPAAEVQCPCHCHPAGAPAPPRAVPHSSFSLSPPLSSPQCLESFTWARSVRKLEIKSFPL
Specificity
LAMA4 - laminin, alpha 4,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
LAMA4
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Laminin alpha 4 Antibody

  • DKFZp686D23145
  • LAMA3LAMA4*-1
  • LAMA4
  • laminin alpha 4 chain
  • Laminin alpha 4
  • laminin subunit alpha-4
  • laminin, alpha 4
  • Laminin-14 subunit alpha
  • Laminin-8 subunit alpha
  • Laminin-9 subunit alpha

Background

Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Laminins are composed of 3 non identical chains: laminin alpha, beta and gamma (formerly A, B1, and B2, respectively) and they form a cruciform structure consisting of 3 short arms, each formed by a different chain, and a long arm composed of all 3 chains. Each laminin chain is a multidomain protein encoded by a distinct gene. Several isoforms of each chain have been described. Different alpha, beta and gamma chain isomers combine to give rise to different heterotrimeric laminin isoforms which are designated by Arabic numerals in the order of their discovery, i.e. alpha1beta1gamma1 heterotrimer is laminin 1. The biological functions of the different chains and trimer molecules are largely unknown, but some of the chains have been shown to differ with respect to their tissue distribution, presumably reflecting diverse functions in vivo. This gene encodes the alpha chain isoform laminin, alpha 4. The domain structure of alpha 4 is similar to that of alpha 3, both of which resemble truncated versions of alpha 1 and alpha 2, in that approximately 1,200 residues at the N-terminus (domains IV, V and VI) have been lost. Laminin, alpha 4 contains the C-terminal G domain which distinguishes all alpha chains from the beta and gamma chains. The RNA analysis from adult and fetal tissues revealed developmental regulation of expression, however, the exact function of laminin, alpha 4 is not known. Tissue-specific utilization of alternative polyA-signal has been described in literature. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46622
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
AF6585
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-91800
Species: Hu
Applications: WB, IHC, IHC-P
AF2918
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB300-144
Species: Hu, Mu, Rt, In, Rb, Sh
Applications: WB, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-30961
Species: Hu
Applications: WB, ChIP, IHC, IHC-P
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-46624
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-314
Species: Hu
Applications: WB, IP, PLA
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003910-B02P
Species: Hu
Applications: WB

Publications for Laminin alpha 4 Antibody (H00003910-B02P) (0)

There are no publications for Laminin alpha 4 Antibody (H00003910-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Laminin alpha 4 Antibody (H00003910-B02P) (0)

There are no reviews for Laminin alpha 4 Antibody (H00003910-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Laminin alpha 4 Antibody (H00003910-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Laminin alpha 4 Products

Bioinformatics Tool for Laminin alpha 4 Antibody (H00003910-B02P)

Discover related pathways, diseases and genes to Laminin alpha 4 Antibody (H00003910-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Laminin alpha 4 Antibody (H00003910-B02P)

Discover more about diseases related to Laminin alpha 4 Antibody (H00003910-B02P).
 

Pathways for Laminin alpha 4 Antibody (H00003910-B02P)

View related products by pathway.

PTMs for Laminin alpha 4 Antibody (H00003910-B02P)

Learn more about PTMs related to Laminin alpha 4 Antibody (H00003910-B02P).

Blogs on Laminin alpha 4

There are no specific blogs for Laminin alpha 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Laminin alpha 4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LAMA4
Entrez
Uniprot