Home » Lamin B2 » Lamin B2 Antibodies » Lamin B2 Antibody

Lamin B2 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: Lamin B2 Antibody [NBP2-48882] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: Human Tonsil tissue
Western Blot: Lamin B2 Antibody [NBP2-48882] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: Lamin B2 Antibody [NBP2-48882] - Staining in human cerebral cortex and liver tissues using anti-LMNB2 antibody. Corresponding LMNB2 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: Lamin B2 Antibody [NBP2-48882] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: Lamin B2 Antibody [NBP2-48882] - Staining of human liver shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

Lamin B2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DEVNKSAKKREGELTVAQGRVKDLESLFHRSEVELAAALSDKRGLESDVAELRAQLAKAEDGHAVAKKQLEKETLM
Specificity
Specificity of human Lamin B2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LMNB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Lamin B2 Recombinant Protein Antigen (NBP2-48882PEP)

Reactivity Notes

Mouse (89%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Lamin B2 Antibody

  • lamin B2
  • lamin-B2
  • LMN2LAMB2
  • MGC2721

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Lamin B1 Antibody
(CL3929)
NBP2-59783
Western Blot: Lamin B1 Antibody (CL3929) [NBP2-59783] - Analysis in human cell line MCF-7.
Immunocytochemistry/Immunofluorescence: Lamin B1 Antibody (CL3929) [NBP2-59783] - Staining of A-431 cells showing specific staining of nuclear membrane in green. Microtubule and nuclear probes are visualized in red and blue, respectively (where available). Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Lamin B1 Antibody (CL3929) [NBP2-59783] - Staining of human colon shows nuclear membrane positivity in glandular and connective tissue cells.
(2 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Lamin A + C
Antibody
NB100-56649
Western Blot: Lamin A + C Antibody [NB100-56649] - Analysis of human Lamin A + C in 15 ug of HeLa cell lysate using NB100-56649 at 1:1000.
Immunocytochemistry/Immunofluorescence: Lamin A + C Antibody [NB100-56649] - Lamin A/C antibody was tested in A431 cells at 1:100 against DyLight 488 (Green). Alpha tubulin and nuclei were counterstained against DyLight 568 (Red) and DAPI (Blue).
Flow (Intracellular): Lamin A + C Antibody [NB100-56649] - Intracellular staining of HeLa cells (1 x 10^6 cells/mL) with Lamin A+C antibody (orange) stained at 1:1000. Detected with a GtxRb DyLight 488 secondary. Shown with the secondary only control (blue).
(5 Publications)
Species: Hu
Applications: WB, ICC/IF, Flow-IC
CD20 Antibody (L26)
NBP2-44743
Western Blot: CD20 Antibody (L26) [NBP2-44743] - Western Blot Analysis of Raji cell lysate using CD20 Mouse Monoclonal Antibody (L26).
Immunocytochemistry/Immunofluorescence: CD20 Antibody (L26) [NBP2-44743] - Immunofluorescence staining of Raji cells using CD20 Mouse Monoclonal Antibody (L26) followed by goat anti-Mouse IgG conjugated to CF488 (green). Nuclei are stained with Reddot.
Immunohistochemistry-Paraffin: MS4A1/CD20 Antibody (L26) [NBP2-44743] - Human Lymphoma stained with CD20 Monoclonal Antibody (L26)
(1 Publication)
Species: Hu, Pm, Pm, Bv(-), Ca(-), Po(-), Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IF
BBS9 Antibody
NBP1-88927
Immunohistochemistry-Paraffin: BBS9 Antibody [NBP1-88927] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
(3 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
SPANXB1 Antibody
H00728695-B01P
Western Blot: SPANXB1 Antibody [H00728695-B01P] - Analysis of SPANXB1 expression in transfected 293T cell line by SPANXB1 polyclonal antibody. Lane 1: SPANXB1 transfected lysate(11.33 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: SPANXB1 Antibody [H00728695-B01P] - Analysis of purified antibody to SPANXB1 on Hs 181.Tes cell. (antibody concentration 10 ug/ml)
Species: Hu
Applications: WB, ICC/IF, IP
Nephrin Antibody
[Unconjugated]
AF3159
Nephrin was detected in perfusion fixed frozen sections of mouse kidney using 10 µg/mL Goat Anti-Mouse Nephrin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3159) overnight at 4 °C. Tissue was stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained (green). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Nephrin was detected in perfusion fixed frozen sections of mouse kidney using Goat Anti-Mouse Nephrin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3159) at 10 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (yellow; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
(2 Reviews)
(19 Publications)
Species: Mu
Applications: IHC
Podocin/NPHS2
Antibody (JB51-33)
NBP2-75624
Western Blot: Podocin/NPHS2 Antibody (JB51-33) [NBP2-75624] - Analysis of NPHS2 on rat kidney (1) and human kidney (2) tissue lysate using anti-NPHS2 antibody at 1/500 dilution.
Immunohistochemistry-Paraffin: Podocin/NPHS2 Antibody (JB51-33) [NBP2-75624] - Analysis of paraffin-embedded rat kidney tissue using anti-NPHS2 antibody. Counter stained with hematoxylin.
Flow Cytometry: Podocin/NPHS2 Antibody (JB51-33) [NBP2-75624] - Analysis of 293T cells with NPHS2 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti-rabbit IgG was used as the secondary antibody.
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Lamin B Receptor
Antibody
H00003930-B01P
Western Blot: Lamin B Receptor Antibody [H00003930-B01P] - Analysis of LBR expression in transfected 293T cell line by LBR polyclonal antibody. Lane 1: LBR transfected lysate(67.65 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: Lamin B Receptor Antibody [H00003930-B01P] - Analysis of purified antibody to LBR on HeLa cell. (antibody concentration 10 ug/ml)
Immunohistochemistry-Paraffin: Lamin B Receptor Antibody [H00003930-B01P] - Analysis of purified antibody to LBR on formalin-fixed paraffin-embedded human small Intestine. (antibody concentration 3 ug/ml)
(1 Review)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
WT1 Antibody
(6F-H2)
NB110-60011
Western Blot: WT1 Antibody (6F-H2) [NB110-60011] - Hypomethylation of the Intron 1 CpG island results in WT1 expression. RNA was isolated from K562 and U937 cells growing under atmospheric conditions (Normox) and from U937 cells growing in 1% O2 (Hypox) and was analyzed by RT-PCR using primers that span exon 5 of the WT1 mRNA. Ribosomal RNA 36B4 is used as a positive control, and molecular weight markers (MW) are shown. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0119837), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: WT1 Antibody (6F-H2) [NB110-60011] - Staining of human kidney glomerulus tissue. Heat mediated antigen retrieval was performed by heating in citrate buffer (pH 6) at 95C for 20 minutes. Image from verified customer review.
Western Blot: WT1 Antibody (6F-H2) [NB110-60011] - Whole cell protein from human K562, HEK293 and kidney tissue was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-WT1 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
(3 Reviews)
(4 Publications)
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
c-Myc Antibody
NB600-335
Western Blot: c-Myc Antibody [NB600-335] - Detection of c-myc-tagged Protein by Western Blot. Samples: 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein. Antibodies: Affinity purified, goat anti-c-myc antibody NB600-335 used for WB at 0.04 ug/ml (1:25,000). Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunocytochemistry/Immunofluorescence: c-Myc Antibody [NB600-335] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-c-Myc conjugated to Alexa Fluor 488 [NB600-335AF488] at 20ug/ml for 1 hour at room temperature. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective. Image using the Alexa Fluor 488 format of this antibody.
Western Blot: c-Myc Antibody [NB600-335] - Analysis using the HRP conjugate of NB600-335. Detection of 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein. Antibody used for WB at 0.4 ug/ml (1:25,000).
(1 Review)
(49 Publications)
Species: Hu, Mu, Ec, All-NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
CDC2/CDK1 Antibody
NBP1-85729
Western Blot: CDC2/CDK1 Antibody [NBP1-85729] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: CDC2/CDK1 Antibody [NBP1-85729] - Staining of human cell line U-251 MG shows localization to nucleus & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CDC2/CDK1 Antibody [NBP1-85729] - Staining in human tonsil and pancreas tissues. Corresponding CDK1 RNA-seq data are presented for the same tissues.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PLEKHM1 Antibody
NBP2-38449
Immunocytochemistry/Immunofluorescence: PLEKHM1 Antibody [NBP2-38449] - Staining of human cell line U-2 OS shows localization to nucleoli & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PLEKHM1 Antibody [NBP2-38449] - Staining of human small intestine shows moderate cytoplasmic postivity in glandular cells.
Immunohistochemistry-Paraffin: PLEKHM1 Antibody [NBP2-38449] - Staining of human cerebral cortex shows moderate postivity in neuropil.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PPAR gamma/NR1C3
Antibody
NBP2-22106
Western Blot: PPAR gamma/NR1C3 Antibody [NBP2-22106] - Total protein from 3T3-L1 mouse embryonic fibroblast adipose-like cell line, separated by 4-12% SDS-PAGE, transferred to nitrocellulose membrane and blocked in 5% non-fat milk for 1h at room temperature. The membrane was probed with anti-PPAR gamma 1:800 in non-fat milk. Lane 2-7 increasing protein concentration, undifferentiated adipocytes. Lane 8-13 increasing protein concentration, differentiated adipocytes. This image was submitted via customer review.
Immunohistochemistry-Paraffin: PPAR gamma Antibody [NBP2-22106] - IHC analysis of PPAR gamma in mouse liver.
Western Blot: PPAR gamma Antibody [NBP2-22106] - Western blot analysis of PPAR gamma in 1. human adipose and 2. human adrenal lysate.
(2 Reviews)
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
Emerin Antibody
(CL0201)
NBP2-52876
Western Blot: Emerin Antibody (CL0201) [NBP2-52876] - Analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-EMD antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Western Blot: Emerin Antibody (CL0201) [NBP2-52876] - Lane 1: Marker [kDa] Lane 2: Human cell line RT-4
Immunocytochemistry/Immunofluorescence: Emerin Antibody (CL0201) [NBP2-52876] - Staining of PC-3 cells using the Anti-EMD monoclonal antibody, showing specific staining in the nuclear membrane in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available). Antibody staining is shown in green.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Thymopoietin/LAP2
Antibody
NBP1-87822
Western Blot: Thymopoietin/LAP2 Antibody [NBP1-87822] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: Thymopoietin/LAP2 Antibody [NBP1-87822] - Staining of human cell line A-431 shows localization to nuclear membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Thymopoietin/LAP2 Antibody [NBP1-87822] - Staining of human skeletal muscle shows moderate positivity in nuclear membrane in a small subset of myocytes.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
ZMPSTE24 Antibody
NB100-2387
Western Blot: ZMPSTE24 Antibody [NB100-2387] - Detection of ZMPSTE24 in human testis.
Immunocytochemistry/Immunofluorescence: ZMPSTE24 Antibody [NB100-2387] - Analysis of ZMPSTE24 in A549 cells using anti-ZMPSTE24 antibody. Image from verified customer review.
(1 Review)
(2 Publications)
Species: Hu, Mu, Ze
Applications: WB, ICC/IF
Hemoglobin beta
Antibody
NBP2-14081
Immunocytochemistry/Immunofluorescence: Hemoglobin beta Antibody [NBP2-14081] - Staining of human cell line Hep G2 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Hemoglobin beta Antibody [NBP2-14081] - Staining of human placenta shows erythrocyte positivity in vessels.
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Lamin B2 Antibody
NBP2-48882
Lamin B2 Antibody
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Lamin B2 Antibody (NBP2-48882) (0)

There are no publications for Lamin B2 Antibody (NBP2-48882).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lamin B2 Antibody (NBP2-48882) (0)

There are no reviews for Lamin B2 Antibody (NBP2-48882). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Lamin B2 Antibody (NBP2-48882). (Showing 1 - 1 of 1 FAQ).

  1. I'm looking for human lamin antibodies that might cross react with Drosophila lamins. I've found a few that I'm interested in, one of which comes in a smaller sample size. The other two do not have a smaller size ordering option. I was wondering if it would be possible to get these other antibodies in a smaller size as well, so we can test reactivity with Drosophila lamins before ordering the full-sized product?
    • We have a wide range of antibodies to human Lamin. Unfortunately none of these has yet been tested against Drosophila samples, however you may be interested in our Innovator's Reward Program. This allows you to try our primary antibodies in an untested species or application, without the financial risk of failure. To participate you simply complete an online review with an image, detailing the positive or negative results of your study, and in return you receive a discount voucher for 100% of the purchase price of the reviewed product. We are unable to offer free samples of our antibodies but, as you rightly point out, some are available as smaller, sample size aliquots. If a sample size is not listed for a product I am afraid we are unable to offer a smaller aliquot than those already listed.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Lamin B2 Products

Bioinformatics Tool for Lamin B2 Antibody (NBP2-48882)

Discover related pathways, diseases and genes to Lamin B2 Antibody (NBP2-48882). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lamin B2 Antibody (NBP2-48882)

Discover more about diseases related to Lamin B2 Antibody (NBP2-48882).
 

Pathways for Lamin B2 Antibody (NBP2-48882)

View related products by pathway.

Blogs on Lamin B2

There are no specific blogs for Lamin B2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lamin B2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol LMNB2