Lamin B2 Antibody

Images

 
Western Blot: Lamin B2 Antibody [NBP2-48882] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: Lamin B2 Antibody [NBP2-48882] - Staining in human cerebral cortex and liver tissues using anti-LMNB2 antibody. Corresponding LMNB2 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: Lamin B2 Antibody [NBP2-48882] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: Lamin B2 Antibody [NBP2-48882] - Staining of human liver shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Lamin B2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DEVNKSAKKREGELTVAQGRVKDLESLFHRSEVELAAALSDKRGLESDVAELRAQLAKAEDGHAVAKKQLEKETLM
Specificity
Specificity of human Lamin B2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LMNB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Lamin B2 Recombinant Protein Antigen (NBP2-48882PEP)

Reactivity Notes

Mouse (89%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Lamin B2 Antibody

  • lamin B2
  • lamin-B2
  • LMN2LAMB2
  • MGC2721

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59783
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56649
Species: Hu
Applications: WB, ICC/IF, Flow-IC
NBP2-44743
Species: Hu, Pm, Pm, Bv(-), Ca(-), Po(-), Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IF
NBP1-88927
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-75624
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
H00003930-B01P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60011
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB600-335
Species: Hu, Mu, Ec, All-NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-52876
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-87822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-2387
Species: Hu, Mu, Ze
Applications: WB, ICC/IF
NBP2-14081
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-48882
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Lamin B2 Antibody (NBP2-48882) (0)

There are no publications for Lamin B2 Antibody (NBP2-48882).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lamin B2 Antibody (NBP2-48882) (0)

There are no reviews for Lamin B2 Antibody (NBP2-48882). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Lamin B2 Antibody (NBP2-48882). (Showing 1 - 1 of 1 FAQ).

  1. I'm looking for human lamin antibodies that might cross react with Drosophila lamins. I've found a few that I'm interested in, one of which comes in a smaller sample size. The other two do not have a smaller size ordering option. I was wondering if it would be possible to get these other antibodies in a smaller size as well, so we can test reactivity with Drosophila lamins before ordering the full-sized product?
    • We have a wide range of antibodies to human Lamin. Unfortunately none of these has yet been tested against Drosophila samples, however you may be interested in our Innovator's Reward Program. This allows you to try our primary antibodies in an untested species or application, without the financial risk of failure. To participate you simply complete an online review with an image, detailing the positive or negative results of your study, and in return you receive a discount voucher for 100% of the purchase price of the reviewed product. We are unable to offer free samples of our antibodies but, as you rightly point out, some are available as smaller, sample size aliquots. If a sample size is not listed for a product I am afraid we are unable to offer a smaller aliquot than those already listed.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Lamin B2 Products

Bioinformatics Tool for Lamin B2 Antibody (NBP2-48882)

Discover related pathways, diseases and genes to Lamin B2 Antibody (NBP2-48882). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lamin B2 Antibody (NBP2-48882)

Discover more about diseases related to Lamin B2 Antibody (NBP2-48882).
 

Pathways for Lamin B2 Antibody (NBP2-48882)

View related products by pathway.

Blogs on Lamin B2

There are no specific blogs for Lamin B2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lamin B2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LMNB2