LAIR2 Antibody

Images

 
Western Blot: LAIR2 Antibody [NBP1-80500] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LAIR2 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human LAIR2. Peptide sequence SPHLTALLGLVLCLAQTIHTQEGALPRPSISAEPGTVISPGSHVTFMCRG. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LAIR2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against LAIR2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LAIR2 Antibody

  • CD306 antigen
  • CD306
  • CD306leukocyte-associated Ig-like receptor-2
  • LAIR2
  • LAIR-2
  • leukocyte-associated Ig-like receptor 2
  • leukocyte-associated immunoglobulin-like receptor 2
  • MGC71634

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84590
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67691
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MAB1225
Species: Hu
Applications: Flow, Block, CyTOF-reported
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP1-59506
Species: Hu
Applications: WB
NBP2-08750
Species: Hu
NBP1-42664
Species: Hu
Applications: WB, IHC, IP
NBP1-87492
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13893
Species: Hu
Applications: WB, IHC, IHC-P
NB600-586
Species: Hu, Mu, Ca, Fe
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC
AF2940
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
NBP2-80461
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-76421
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF470
Species: Mu
Applications: WB, IHC, Neut
MAB197
Species: Hu
Applications: Flow, IHC, CyTOF-reported, ICC, Neut
MAB2238
Species: Hu
Applications: Flow, AgAct, CyTOF-reported
NBP2-46290
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80500
Species: Hu
Applications: WB

Publications for LAIR2 Antibody (NBP1-80500) (0)

There are no publications for LAIR2 Antibody (NBP1-80500).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LAIR2 Antibody (NBP1-80500) (0)

There are no reviews for LAIR2 Antibody (NBP1-80500). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LAIR2 Antibody (NBP1-80500) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LAIR2 Products

Bioinformatics Tool for LAIR2 Antibody (NBP1-80500)

Discover related pathways, diseases and genes to LAIR2 Antibody (NBP1-80500). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LAIR2 Antibody (NBP1-80500)

Discover more about diseases related to LAIR2 Antibody (NBP1-80500).
 

Pathways for LAIR2 Antibody (NBP1-80500)

View related products by pathway.

Blogs on LAIR2

There are no specific blogs for LAIR2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LAIR2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LAIR2
Uniprot