LAIR2 Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
Synthetic peptide directed towards the N terminal of human LAIR2. Peptide sequence SPHLTALLGLVLCLAQTIHTQEGALPRPSISAEPGTVISPGSHVTFMCRG. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
LAIR2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for LAIR2 Antibody - BSA Free
Background
LAIR2 is encoded by this gene is a member of the immunoglobulin superfamily. It was identified by its similarity to LAIR1, an inhibitory receptor present on mononuclear leukocytes. This gene maps to a region of 19q13.4, termed the leukocyte receptor cluster, which contains 29 genes in the immunoglobulin superfamily, including LAIR1. The function of this protein is unknown, although it is thought to be secreted and may help modulate mucosal tolerance. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IP
Species: Hu
Applications: Block, CyTOF-reported, Flow
Species: Hu
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
Species: Mu
Applications: IHC, Neut, WB
Species: Hu
Applications: CyTOF-reported, Dual ISH-IHC, Flow, ICC, IHC, Neut
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KD
Species: Hu
Applications: AgAct, CyTOF-reported, Flow
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Publications for LAIR2 Antibody (NBP1-80500) (0)
There are no publications for LAIR2 Antibody (NBP1-80500).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for LAIR2 Antibody (NBP1-80500) (0)
There are no reviews for LAIR2 Antibody (NBP1-80500).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for LAIR2 Antibody (NBP1-80500) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional LAIR2 Products
Research Areas for LAIR2 Antibody (NBP1-80500)
Find related products by research area.
|
Blogs on LAIR2