Recombinant Human LAD1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human LAD1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 418 - 517 of Human LAD1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SESVKSRGLPCTELFVAPVGVASKRHLFEKELAGQSRAEPASSRKENLRLSGVVTSRLNLWISRTQESGDQDPQEAQKASSATERTQWGQKSDSSLDAEV

Protein/Peptide Type
Partial Recombinant Protein
Gene
LAD1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LAD1 Protein

  • LAD
  • lad-1
  • LadA
  • ladinin 1
  • ladinin-1
  • linear IgA bullous dermatosis antigen
  • linear IgA disease antigen homolog
  • Linear IgA disease antigen
  • MGC10355

Background

The protein encoded by this gene may be an anchoring filament that is a component of basement membranes. It may contribute to the stability of the association of the epithelial layers with the underlying mesenchyme. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15135
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
AF1008
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-01833
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-33284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
H00003033-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-85892
Species: Hu
Applications: WB, IHC, IHC-P

Publications for LAD1 Partial Recombinant Protein (H00003898-Q01) (0)

There are no publications for LAD1 Partial Recombinant Protein (H00003898-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LAD1 Partial Recombinant Protein (H00003898-Q01) (0)

There are no reviews for LAD1 Partial Recombinant Protein (H00003898-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LAD1 Partial Recombinant Protein (H00003898-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LAD1 Products

LAD1 H00003898-Q01

Bioinformatics Tool for LAD1 Partial Recombinant Protein (H00003898-Q01)

Discover related pathways, diseases and genes to LAD1 Partial Recombinant Protein (H00003898-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LAD1 Partial Recombinant Protein (H00003898-Q01)

Discover more about diseases related to LAD1 Partial Recombinant Protein (H00003898-Q01).
 

Pathways for LAD1 Partial Recombinant Protein (H00003898-Q01)

View related products by pathway.

PTMs for LAD1 Partial Recombinant Protein (H00003898-Q01)

Learn more about PTMs related to LAD1 Partial Recombinant Protein (H00003898-Q01).

Blogs on LAD1

There are no specific blogs for LAD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

LAD1 Antibody
NBP1-86126

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LAD1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LAD1