LACTB Antibody - BSA Free

Western Blot: LACTB Antibody [NBP1-91701] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: LACTB Antibody [NBP1-91701] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: LACTB Antibody [NBP1-91701] - Staining of human testis shows moderate granular cytoplasmic positivity in Leydig cells.

Western Blot: LACTB Antibody [NBP1-91701] - Analysis in human cell line RT-4.

Immunohistochemistry-Paraffin: LACTB Antibody [NBP1-91701] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: LACTB Antibody [NBP1-91701] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: LACTB Antibody [NBP1-91701] - Staining of human testis shows moderate granular cytoplasmic positivity in Leydig cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LACTB Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KEGKSNEKNDFTKFKTEQENEAKCRNSKPGKKKNDFEQGELYLREKFENSIESLRLFKNDPLFFKPGSQFLYSTFGYTLL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LACTB
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  LACTB Recombinant Protein Antigen (NBP1-91701PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LACTB Antibody - BSA Free

• AmpC
• EC 3.4
• FLJ14902
• G24
• lactamase, beta
• mitochondrial 39S ribosomal protein L56
• mitochondrial ribosomal protein L56
• MRPL56
• serine beta lactamase-like protein LACTB
• serine beta-lactamase-like protein LACTB, mitochondrial

Background

This gene encodes a mitochondrially-localized protein that has sequence similarity to prokaryotic beta-lactamases. Many of the residues responsible for beta-lactamase activity are not conserved in this protein, suggesting it may have a different enzymatic function. Increased expression of the related mouse gene was found to be associated with obesity. Alternative splicing results in multiple transcript variants encoding different protein isoforms. [provided by RefSeq, Dec 2013]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LACTB