L2HGDH Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: L2HGDH Antibody [NBP2-57724] - Staining of human cell line RT4 shows localization to mitochondria.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

L2HGDH Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ISDILRGPAGVRAQALDRDGNLVEDFVFDAGVGDIGNRILHVRNAPSPAATSSIAISGMIADEVQQRFEL
Specificity
Specificity of human L2HGDH antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
L2HGDH
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
L2HGDH Recombinant Protein Antigen (NBP2-57724PEP)

Reactivity Notes

Mouse 83%, Rat 83%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for L2HGDH Antibody

  • 2-hydroxyglutarate dehydrogenase
  • alpha-ketoglutarate reductase
  • C14orf160alpha-hydroxyglutarate oxidoreductase
  • chromosome 14 open reading frame 160
  • DURANIN
  • EC 1.1.99.2
  • FLJ12618
  • L-2-hydroxyglutarate dehydrogenase
  • L-2-hydroxyglutarate dehydrogenase, mitochondrial
  • L-alpha-hydroxyglutarate dehydrogenase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88361
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
NBP2-24716
Species: Hu, Mu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22166
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47804
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KO
NB100-182
Species: Hu, Mu, Rt, Av, Ca, Ma, Pm, Ze
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, RNAi, KD, KO
NBP1-89627
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-42388
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-89284
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-57642
Species: Hu
Applications: WB, IHC, IHC-P
7954-GM/CF
Species: Hu
NB100-74510
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-71055
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, CyTOF-ready
NBP1-85871
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87408
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-83950
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-2527
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD

Publications for L2HGDH Antibody (NBP2-57724) (0)

There are no publications for L2HGDH Antibody (NBP2-57724).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for L2HGDH Antibody (NBP2-57724) (0)

There are no reviews for L2HGDH Antibody (NBP2-57724). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for L2HGDH Antibody (NBP2-57724) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional L2HGDH Products

Bioinformatics Tool for L2HGDH Antibody (NBP2-57724)

Discover related pathways, diseases and genes to L2HGDH Antibody (NBP2-57724). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for L2HGDH Antibody (NBP2-57724)

Discover more about diseases related to L2HGDH Antibody (NBP2-57724).
 

Pathways for L2HGDH Antibody (NBP2-57724)

View related products by pathway.

Blogs on L2HGDH

There are no specific blogs for L2HGDH, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our L2HGDH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol L2HGDH