alpha-Aminoadipate Aminotransferase Antibody

Images

 
Western Blot: alpha-Aminoadipate Aminotransferase Antibody [NBP1-89627] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-8
Immunocytochemistry/ Immunofluorescence: alpha-Aminoadipate Aminotransferase Antibody [NBP1-89627] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane.
Immunohistochemistry-Paraffin: alpha-Aminoadipate Aminotransferase Antibody [NBP1-89627] - Staining of human liver shows cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

alpha-Aminoadipate Aminotransferase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AADAT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
alpha-Aminoadipate Aminotransferase Protein (NBP1-89627PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for alpha-Aminoadipate Aminotransferase Antibody

  • AADAT
  • alphaAminoadipate Aminotransferase
  • alpha-Aminoadipate Aminotransferase
  • aminoadipate aminotransferase
  • EC 2.6.1.39,2-aminoadipate aminotransferase
  • EC 2.6.1.7,2-aminoadipate transaminase
  • KAT/AadAT
  • KAT2
  • KAT2mitochondrial
  • Kynurenine aminotransferase II
  • Kynurenine--oxoglutarate aminotransferase II
  • Kynurenine--oxoglutarate transaminase II
  • L kynurenine/alpha aminoadipate aminotransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01383
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1103
Species: Hu
Applications: WB, IHC, ICC
AF7817
Species: Hu, Mu, Rt
Applications: WB
NBP1-87835
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29936
Species: Hu, Mu
Applications: WB, Flow, IHC-P
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
MAB7389
Species: Mu
Applications: WB, IHC
AF23151
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-48549
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC-P
NBP2-19775
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89627
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for alpha-Aminoadipate Aminotransferase Antibody (NBP1-89627) (0)

There are no publications for alpha-Aminoadipate Aminotransferase Antibody (NBP1-89627).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alpha-Aminoadipate Aminotransferase Antibody (NBP1-89627) (0)

There are no reviews for alpha-Aminoadipate Aminotransferase Antibody (NBP1-89627). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for alpha-Aminoadipate Aminotransferase Antibody (NBP1-89627) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional alpha-Aminoadipate Aminotransferase Products

Bioinformatics Tool for alpha-Aminoadipate Aminotransferase Antibody (NBP1-89627)

Discover related pathways, diseases and genes to alpha-Aminoadipate Aminotransferase Antibody (NBP1-89627). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for alpha-Aminoadipate Aminotransferase Antibody (NBP1-89627)

Discover more about diseases related to alpha-Aminoadipate Aminotransferase Antibody (NBP1-89627).
 

Pathways for alpha-Aminoadipate Aminotransferase Antibody (NBP1-89627)

View related products by pathway.

PTMs for alpha-Aminoadipate Aminotransferase Antibody (NBP1-89627)

Learn more about PTMs related to alpha-Aminoadipate Aminotransferase Antibody (NBP1-89627).
 

Research Areas for alpha-Aminoadipate Aminotransferase Antibody (NBP1-89627)

Find related products by research area.

Blogs on alpha-Aminoadipate Aminotransferase

There are no specific blogs for alpha-Aminoadipate Aminotransferase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our alpha-Aminoadipate Aminotransferase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AADAT
Entrez