We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

L1CAM Recombinant Protein Antigen

Images

 
There are currently no images for L1CAM Protein (NBP1-86544PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

L1CAM Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human L1CAM.

Source: E. coli

Amino Acid Sequence: ELRTHNLTDLSPHLRYRFQLQATTKEGPGEAIVREGGTMALSGISDFGNISATAGENYSVVSWVPKEGQCNFRFHILFKALGEEKGGASLSPQYVSYNQSSYTQWDLQPDTDYEIHLFKERMFRHQMAVKTNGTGRVRLPPAGFATE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
L1CAM
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86544.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for L1CAM Recombinant Protein Antigen

  • antigen identified by monoclonal R1
  • CAML1
  • CAML1N-CAML1
  • CD171 antigen
  • CD171
  • HSAS
  • HSAS1
  • L1 cell adhesion molecule
  • L1CAM
  • MASA
  • MIC5
  • N-CAM-L1
  • NCAM-L1
  • neural cell adhesion molecule L1
  • S10
  • SPG1

Background

The L1CAM gene, which is located in Xq28, is involved in three distinct conditions: 1) HSAS (hydrocephalus-stenosis of the aqueduct of Sylvius); 2) MASA (mental retardation, aphasia, shuffling gait, adductus thumbs); and 3) SPG1 (spastic paraplegia). The L1, neural cell adhesion molecule (L1CAM) also plays an important role in axon growth, fasciculation, neural migration and in mediating neuronal differentiation. Expression of L1 protein is restricted to tissues arising from neuroectoderm.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88582
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF2408
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
NB100-65530
Species: Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-94502
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
AF4670
Species: Hu
Applications: CyTOF-ready, Flow, IHC, KO, Neut, WB
AF4036
Species: Hu
Applications: Simple Western, WB
DKK300
Species: Hu
Applications: ELISA
NBP3-48658
Species: Ca, Fe, Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-32920
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
H00005324-M02
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, WB
NB100-1595
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP2-54591
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, PA
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP3-32997
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-33691
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-73636
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, WB
H00006201-M03
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP1-87797
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, Simple Western, WB
NBP2-20215
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-46191
Species: Dr, Hu, Mu
Applications: IP, WB

Publications for L1CAM Protein (NBP1-86544PEP) (0)

There are no publications for L1CAM Protein (NBP1-86544PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for L1CAM Protein (NBP1-86544PEP) (0)

There are no reviews for L1CAM Protein (NBP1-86544PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for L1CAM Protein (NBP1-86544PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional L1CAM Products

Research Areas for L1CAM Protein (NBP1-86544PEP)

Find related products by research area.

Blogs on L1CAM.

Identifying tumoral and stromal transcriptomes that underlie tumor plasticity and stromal neuroinflammatory response in brain metastasis
By Jamshed Arslan, Pharm. D., PhD. Cancers in the brain often come from tumors elsewhere in the body. Several adaptive mechanisms influence brain metastasis, such as blood brain barrier leakage that can be induced by ...  Read full blog post.

Customers Who Bought This Also Bought

GFAP Antibody
NB300-141

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our L1CAM Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol L1CAM