Kynurenine 3-Monooxygenase/KMO Antibody - BSA Free

Immunohistochemistry-Paraffin: Kynurenine 3-Monooxygenase/KMO Antibody [NBP2-54915] - Immunohistochemical staining of human kidney shows strong cytopalsmic positivity in cells in tubules.

Staining of human endometrium, kidney, liver and testis using NBP2-54915 (A) shows similar protein distribution across tissues to independent antibody NBP1-86335 (B).

Staining of human liver shows strong cytoplasmic granular positivity in hepatocytes.

Staining of human kidney shows strong cytoplasmic granular positivity in cells in tubules.

Staining of human endometrium shows strong cytoplasmic granular positivity in glandular cells.

Analysis in human liver and testis tissues. Corresponding KMO RNA-seq data are presented for the same tissues.

Staining of human testis shows no positivity in cells in seminiferous ducts as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Kynurenine 3-Monooxygenase/KMO Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IALPNMNKSFTCTLFMPFEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKLLVQDFFLLPAQPMISVKCSSFHFKSHCVLLGDAAHAI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KMO
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Kynurenine 3-Monooxygenase/KMO Recombinant Protein Antigen (NBP2-54915PEP)

Reactivity Notes

Mouse 83%, Rat 81%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Kynurenine 3-Monooxygenase/KMO Antibody - BSA Free

• KMO
• kynurenine 3-monooxygenase (kynurenine 3-hydroxylase)
• Kynurenine 3Monooxygenase
• Kynurenine 3-Monooxygenase

Background

Kynurenine 3-monooxygenase (KMO; EC 1.14.13.9) is an NADPH-dependent flavin monooxygenase that catalyzes the hydroxylation of the L-tryptophan metabolite L-kynurenine to form L-3-hydroxykynurenine.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KMO