Kynureninase Antibody - BSA Free

Western Blot: Kynureninase Antibody [NBP2-14180] - Analysis in human cell lines A-549 and HEK293 using anti-KYNU antibody. Corresponding KYNU RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.

Immunocytochemistry/Immunofluorescence: Kynureninase Antibody [NBP2-14180] - Staining of human cell line A549 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Kynureninase Antibody [NBP2-14180] - Staining in human liver and skeletal muscle tissues using anti-KYNU antibody. Corresponding KYNU RNA-seq data are presented for the same tissues.

Western Blot: Kynureninase Antibody [NBP2-14180] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-308

Immunohistochemistry-Paraffin: Kynureninase Antibody [NBP2-14180] - Staining of human liver shows high expression.

Immunohistochemistry-Paraffin: Kynureninase Antibody [NBP2-14180] - Staining of human skeletal muscle shows low expression as expected.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Kynureninase Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Kynureninase Antibody - BSA Free (NBP2-14180) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: YAIESQLQLHGLNIEESMRMIKPREGEETLRIEDILEVIEKEGDSIAVILFSGVHFYTGQHFNIPAITKAGQAKGCYVGFDLAHAVGNVELYLHDWGVDFACWCSYKYLNAGAGGIAGAFIHEKHAHTIKPALVGWFGHELSTRFK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KYNU
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  Kynureninase Protein (NBP2-14180PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Kynureninase Antibody - BSA Free

• EC 3.7.1.3
• KYNU
• kynureninase (L-kynurenine hydrolase)
• Kynureninase
• L-kynurenine hydrolase

Background

KYNU, also known as Kynureninase, has a 465 amino acid long isoform that is 52 kDa and a short 307 amino acid that is 35 kDa; its highest expressed levels are found in placenta, liver and lung; is a PLP dependent enzyme that catalyses the cleavage of kynurenine (Kyn) into anthranilic acid (Ant), and It can also act on 3hKyn (to produce 3hAnt) and some other (3-arylcarbonyl)-alanines, and has cysteine-conjugate-beta-lyase activity. This protein is currently being studied for research on the following diseases and disorders: transient cerebral ischemia, vitamin b deficiency, hydroxykynureninuria, pellagra, cerebritis, ischemia, atopic dermatitis, intrahepatic cholangiocarcinoma, essential hypertension, noma, brain injury, dermatitis, psoriasis cholangiocarcinoma, neurologic diseases, interferon, and neuronitis. Interactions with KYNU protein have been shown to involve 40 proteins including GCK, PIN1, NEDD4L, HSPA9, and ETFA in tryptophan catabolism, metabolism, metabolism of amino acids and derivatives, and NAD metabolism pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KYNU