Kynureninase Antibody

Images

 
Western Blot: Kynureninase Antibody [NBP2-14180] - Analysis in human cell lines A-549 and HEK293 using anti-KYNU antibody. Corresponding KYNU RNA-seq data are presented for the same cell lines. Loading control: ...read more
Immunocytochemistry/ Immunofluorescence: Kynureninase Antibody [NBP2-14180] - Staining of human cell line A549 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Kynureninase Antibody [NBP2-14180] - Staining in human liver and skeletal muscle tissues using anti-KYNU antibody. Corresponding KYNU RNA-seq data are presented for the same tissues.
Western Blot: Kynureninase Antibody [NBP2-14180] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-308
Immunohistochemistry-Paraffin: Kynureninase Antibody [NBP2-14180] - Staining of human liver shows high expression.
Immunohistochemistry-Paraffin: Kynureninase Antibody [NBP2-14180] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Kynureninase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YAIESQLQLHGLNIEESMRMIKPREGEETLRIEDILEVIEKEGDSIAVIL FSGVHFYTGQHFNIPAITKAGQAKGCYVGFDLAHAVGNVELYLHDWGVDF ACWCSYKYLNAGAGGIAGAFIHEKHAHTIKPALVGWFGHELSTRFK
Specificity
Specificity of human Kynureninase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KYNU
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Kynureninase Protein (NBP2-14180PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Kynureninase Antibody

  • EC 3.7.1.3
  • KYNU
  • kynureninase (L-kynurenine hydrolase)
  • Kynureninase
  • L-kynurenine hydrolase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45995
Species: Hu
Applications: WB, IHC
NBP1-86335
Species: Hu
Applications: IHC, IHC-P
NBP1-85892
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87702
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-24646
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, IHC-P
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-59322
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89627
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86108
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP1-32284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87223
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00057085-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-55298
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14180
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Kynureninase Antibody (NBP2-14180) (0)

There are no publications for Kynureninase Antibody (NBP2-14180).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kynureninase Antibody (NBP2-14180) (0)

There are no reviews for Kynureninase Antibody (NBP2-14180). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Kynureninase Antibody (NBP2-14180) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kynureninase Products

Bioinformatics Tool for Kynureninase Antibody (NBP2-14180)

Discover related pathways, diseases and genes to Kynureninase Antibody (NBP2-14180). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kynureninase Antibody (NBP2-14180)

Discover more about diseases related to Kynureninase Antibody (NBP2-14180).
 

Pathways for Kynureninase Antibody (NBP2-14180)

View related products by pathway.

PTMs for Kynureninase Antibody (NBP2-14180)

Learn more about PTMs related to Kynureninase Antibody (NBP2-14180).

Blogs on Kynureninase

There are no specific blogs for Kynureninase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kynureninase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KYNU
Entrez