Ku70/XRCC6 Antibody (8L6B6)

Immunohistochemistry-Paraffin: Ku70/XRCC6 Antibody (8L6B6) [NBP3-15358] - Immunohistochemistry of paraffin-embedded human colon carcinoma using Ku70/XRCC6 Rabbit mAb (NBP3-15358) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Western Blot: Ku70/XRCC6 Antibody (8L6B6) [NBP3-15358] - Analysis of lysates from A-549 cells using Ku70 Rabbit mAb at 1:6000 dilution incubated overnight at 4℃.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 10s.

Immunocytochemistry/Immunofluorescence: Ku70/XRCC6 Antibody (8L6B6) [NBP3-15358] -Confocal imaging of U-2 OS cells using Ku70 Rabbit mAb (dilution 1:100)(Red). The cells were counterstained with alpha -Tubulin Mouse mAb (dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Immunohistochemistry-Paraffin: Ku70/XRCC6 Antibody (8L6B6) [NBP3-15358] -Analysis of paraffin-embedded Human tonsil tissue using Ku70 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry-Paraffin: Ku70/XRCC6 Antibody (8L6B6) [NBP3-15358] -Analysis of paraffin-embedded Human esophagus tissue using Ku70 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: Ku70/XRCC6 Antibody (8L6B6) [Ku70/XRCC6] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using Ku70/XRCC6 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: Ku70/XRCC6 Antibody (8L6B6) [Ku70/XRCC6] - Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using Ku70/XRCC6 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: Ku70/XRCC6 Antibody (8L6B6) [Ku70/XRCC6] - Confocal imaging of U-2 OS cells using Ku70/XRCC6 Rabbit mAb . The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Immunohistochemistry: Ku70/XRCC6 Antibody (8L6B6) [Ku70/XRCC6] - Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Ku70/XRCC6 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Western Blot: Ku70/XRCC6 Antibody (8L6B6) [Ku70/XRCC6] - Western blot analysis of lysates from A-549 cells using Ku70/XRCC6 Rabbit mAb at 1:6000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 10s.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 8L6B6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Ku70/XRCC6 Antibody (8L6B6) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500-609 of human Ku70/XRCC6 (P12956). PEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELLEALTKHFQD
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: XRCC6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunocytochemistry/ Immunofluorescence 1:100 - 1:1000
  • Immunohistochemistry 1:200 - 1:800
  • Immunohistochemistry-Paraffin 1:200 - 1:800
  • Western Blot 1:6000 - 1:36000
• Theoretical MW: 70 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Ku70/XRCC6 Antibody (8L6B6)

• 5'-deoxyribose-5-phosphate lyase Ku70
• 5'-dRP lyase Ku70
• 70 kDa subunit of Ku antigen
• ATP-dependent DNA helicase 2 subunit 1
• ATP-dependent DNA helicase II 70 kDa subunit
• CTC box binding factor 75 kDa subunit
• CTC box-binding factor 75 kDa subunit
• CTC75
• CTCBF
• D22S731
• EC 3.6.4.-
• EC 4.2.99.-
• G22P1
• G22P1Ku70
• Ku autoantigen p70 subunit
• Ku autoantigen, 70kDa
• Ku70
• ML8
• ML8,70 kDa subunit
• thyroid-lupus autoantigen p70
• Thyroid-lupus autoantigen
• TLAA
• TLAAD22S671
• X-ray repair complementing defective repair in Chinese hamster cells 6DNA repair protein XRCC6
• X-ray repair cross-complementing protein 6
• XRCC6

Background

The Ku autoantigen is a heterodimer of 70kDa (p70) and ~80kDa (p80) proteins. The p70/p80 dimer is important for function of a 460kDa DNAdependent protein kinase that phosphorylates certain transcription factors, including Sp1, Oct-1, p53, and SV40 large T antigen in vitro. Ku protein plays a role in cell signaling, proliferation, DNA repair, replication, transcriptional activation, and apoptosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: XRCC6