KRT82 Antibody


Immunohistochemistry-Paraffin: KRT82 Antibody [NBP2-31727] - Staining of human hair follicle shows strong positivity in the cuticle layer.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

KRT82 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: SSSKGAFLYEPCGVSTPVLSTGVLRSNGGCSIVGTGELYVPCEPQGLLSCGSGRKSSMTLGAG
Specificity of human KRT82 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KRT82 Recombinant Protein Antigen (NBP2-31727PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for KRT82 Antibody

  • Hard Keratin, Type II, 2
  • HB2
  • Hb-2
  • K82
  • keratin 82
  • Keratin, Hair, Basic, 2
  • Keratin, Type II Cuticular Hb2
  • Keratin-82
  • KRTHB2
  • Type II Hair Keratin Hb2
  • Type-II Keratin Kb22


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu, Rt, Bv, Ca
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu
Species: Hu, Mu, Rt, Po, Ca, Eq, Pm
Applications: WB
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, ChHa, SyHa, Ha, Md, Pm, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu, Mu, Rt, Po, Bv, Eq, Gt, GP, Rb
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Species: Hu
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P

Publications for KRT82 Antibody (NBP2-31727) (0)

There are no publications for KRT82 Antibody (NBP2-31727).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KRT82 Antibody (NBP2-31727) (0)

There are no reviews for KRT82 Antibody (NBP2-31727). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KRT82 Antibody (NBP2-31727) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional KRT82 Products

KRT82 NBP2-31727

Bioinformatics Tool for KRT82 Antibody (NBP2-31727)

Discover related pathways, diseases and genes to KRT82 Antibody (NBP2-31727). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on KRT82

There are no specific blogs for KRT82, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our KRT82 Antibody and receive a gift card or discount.


Gene Symbol KRT82