KRR1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: KRR1 Antibody [NBP1-92060] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & nucleoli.

Immunohistochemistry-Paraffin: KRR1 Antibody [NBP1-92060] - Staining of human urinary bladder shows moderate positivity in cytoplasm and nucleoli.

Western Blot: KRR1 Antibody [NBP1-92060] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KRR1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KRR1 Antibody - BSA Free (NBP1-92060) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LKANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTETKIDVASIKEKVKKAKNKKLGALTAEEIALKMEAD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KRR1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500-1:5000
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  KRR1 Protein (NBP1-92060PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for KRR1 Antibody - BSA Free

• HIV-1 Rev binding protein 2
• HIV-1 Rev-binding protein 2
• HRB2
• KRR1 small subunit processome component homolog
• KRR1, small subunit (SSU) processome component, homolog (yeast)
• Rev interacting protein
• Rev-interacting protein 1
• RIP-1

Background

KRR1 is required for 40S ribosome biogenesis. Involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KRR1