Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | IHC |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Format | BSA Free |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDV |
Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | KRAS |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP2-33579 | Applications | Species |
---|---|---|
Kim DG, Choi Y, Lee Y et al. AIMP2-DX2 provides therapeutic interface to control KRAS-driven tumorigenesis Nature communications 2022-05-11 [PMID: 35546148] (IF/IHC, WB) | IF/IHC, WB |
Secondary Antibodies |
Isotype Controls |
Research Areas for KRAS Antibody (NBP2-33579)Find related products by research area.
|
Understanding ‘Y’ in Breast Cancer: Crucial Role of DNA/RNA-binding Protein YB-1 in the Development, Pre-Invasive, and Metastatic Phases Jamshed Arslan, Pharm D, PhD In the United States, 1 in 8 women will be diagnosed with breast cancer in her lifetime.1 Despite the prevalence, cancer genesis is a mystery. The heterogeneity of cancers makes it diff... Read full blog post. |
Autophagy: Pro or Anti-tumorigenic? And the role of epigenetics in this debate By Christina Towers, PhDAutophagy is an evolutionarily conserved process that cells use to break down damaged cytoplasmic constituents in order to fuel cellular metabolism, particularly in instances of stress. This process has been heavily ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.