KPNA6 Antibody

Images

 
Western Blot: KPNA6 Antibody [NBP1-83762] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: KPNA6 Antibody [NBP1-83762] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: KPNA6 Antibody [NBP1-83762] - Staining of human kidney shows strong nuclear positivity in cells in tubules and cells in glomeruli.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KPNA6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RRREEEGIQLRKQKREQQLFKRRNVELINEEAAMFDSLLMDSYVSSTTGESVITREMVEMLFSDDSDLQLATTQKFR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KPNA6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KPNA6 Protein (NBP1-83762PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KPNA6 Antibody

  • importin alpha 7 subunit
  • importin subunit alpha-7
  • importin-alpha-S2
  • IPOA7FLJ11249
  • karyopherin alpha 6 (importin alpha 7)
  • Karyopherin subunit alpha-6
  • KPNA7
  • MGC17918

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003836-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-52501
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NBP2-59072
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-Fr, IHC-P, MeDIP
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-19586
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-20387
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-98293
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NBP2-24590
Species: Mu
Applications: WB, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00057154-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-81650
Species: Hu
Applications: WB, IHC, IHC-P, IP, PLA
MAB8209
Species: Hu, Mu, Rt
Applications: WB, ICC
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-24600
Species: Hu, Mu
Applications: WB

Publications for KPNA6 Antibody (NBP1-83762) (0)

There are no publications for KPNA6 Antibody (NBP1-83762).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KPNA6 Antibody (NBP1-83762) (0)

There are no reviews for KPNA6 Antibody (NBP1-83762). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for KPNA6 Antibody (NBP1-83762) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KPNA6 Products

Bioinformatics Tool for KPNA6 Antibody (NBP1-83762)

Discover related pathways, diseases and genes to KPNA6 Antibody (NBP1-83762). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KPNA6 Antibody (NBP1-83762)

Discover more about diseases related to KPNA6 Antibody (NBP1-83762).
 

Pathways for KPNA6 Antibody (NBP1-83762)

View related products by pathway.

PTMs for KPNA6 Antibody (NBP1-83762)

Learn more about PTMs related to KPNA6 Antibody (NBP1-83762).
 

Research Areas for KPNA6 Antibody (NBP1-83762)

Find related products by research area.

Blogs on KPNA6

There are no specific blogs for KPNA6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KPNA6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KPNA6