Klotho beta Antibody - BSA Free

Western Blot: Klotho beta Antibody [NBP3-09315] - Western blot analysis of Klotho beta in 721_B Whole Cell lysates. Antibody dilution at 0.5ug/ml

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Klotho beta Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Klotho beta Antibody - BSA Free (NBP3-09315) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human Klotho beta (NP_783864). Peptide sequence DAYTIRRGLFYVDFNSKQKERKPKSSAHYYKQIIRENGFSLKESTPDVQG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KLB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Western Blot 1.0 ug/ml
• Theoretical MW: 120 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Klotho beta Antibody - BSA Free

• betaKlotho
• beta-klotho
• BKL
• KLB
• klotho beta like
• Klotho beta
• klotho beta-like protein
• MGC142213

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KLB