KLHL6 Antibody

Images

 
Immunohistochemistry-Paraffin: KLHL6 Antibody [NBP1-83880] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KLHL6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GDVVEKSLEGPLAPSTDEPSQKTGDLVEILNGEKVKFDDAGLSLILQNGLETLRMENALTDVILCVDIQEFSCHRVVLAAASNYFRAM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KLHL6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KLHL6 Protein (NBP1-83880PEP)

Reactivity Notes

Mouse (86%), Rat (86%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KLHL6 Antibody

  • FLJ00029
  • kelch-like 6 (Drosophila)
  • kelch-like protein 6
  • kelch-like protein KLHL6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NB100-58788
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-31369
Species: Hu
Applications: WB, IHC, IHC-P
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
NBP1-19788
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-56152
Species: Hu
Applications: ICC/IF
MAB2698
Species: Hu
Applications: WB, IHC, ICC
NBP2-02939
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF
NBP2-46157
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF2699
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
AF5486
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NBP1-88932
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7158
Species: Hu, Mu
Applications: WB, IHC
NBP1-83880
Species: Hu
Applications: IHC, IHC-P

Publications for KLHL6 Antibody (NBP1-83880) (0)

There are no publications for KLHL6 Antibody (NBP1-83880).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLHL6 Antibody (NBP1-83880) (0)

There are no reviews for KLHL6 Antibody (NBP1-83880). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KLHL6 Antibody (NBP1-83880) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KLHL6 Products

Bioinformatics Tool for KLHL6 Antibody (NBP1-83880)

Discover related pathways, diseases and genes to KLHL6 Antibody (NBP1-83880). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLHL6 Antibody (NBP1-83880)

Discover more about diseases related to KLHL6 Antibody (NBP1-83880).
 

Pathways for KLHL6 Antibody (NBP1-83880)

View related products by pathway.

PTMs for KLHL6 Antibody (NBP1-83880)

Learn more about PTMs related to KLHL6 Antibody (NBP1-83880).

Blogs on KLHL6

There are no specific blogs for KLHL6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KLHL6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KLHL6