KLHL9 Antibody - BSA Free

Western Blot: KLHL9 Antibody [NBP3-04398] - Analysis of extracts of 293T cells, using KLHL9 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit .

Immunohistochemistry-Paraffin: KLHL9 Antibody [NBP3-04398] - Paraffin-embedded mouse testis using KLHL9 antibody at dilution of 1:100 (40x lens).

Immunohistochemistry-Paraffin: KLHL9 Antibody [NBP3-04398] - Paraffin-embedded rat ovary using KLHL9 antibody at dilution of 1:100 (40x lens).

Immunohistochemistry-Paraffin: KLHL9 Antibody [NBP3-04398] - Paraffin-embedded rat heart using KLHL9 antibody at dilution of 1:100 (40x lens).

Immunohistochemistry-Paraffin: KLHL9 Antibody [NBP3-04398] - Paraffin-embedded human breast cancer using KLHL9 antibody at dilution of 1:100 (40x lens).

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KLHL9 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KLHL9 Antibody - BSA Free (NBP3-04398) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human KLHL9 (NP_061335.1). MKVSLGNGEMGVSAHLQPCKAGTTRFFTSNTHSSVVLQGFDQLRIEGLLCDVTLVPGDGDEIFPVHRAMMASASDYFKAMFTGGMKEQDLMCIKLHGVNK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KLHL9
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:2000
• Theoretical MW: 69 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for KLHL9 Antibody - BSA Free

• FLJ13568
• FLJ21815
• kelch-like 9 (Drosophila)
• kelch-like protein 9
• KIAA1354

Background

Substrate-specific adapter for a CUL3-based E3 ubiquitin-protein ligase complex. Within this complex, controls the dynamic behavior of AURKB on mitotic chromosomes and thereby coordinates faithful mitotic progression and completion of cytokinesis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KLHL9