KLF9 Antibody (2B9) - Azide and BSA Free

Sandwich ELISA: KLF9 Antibody (2B9) [H00000687-M02] - Detection limit for recombinant GST tagged KLF9 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: ELISA
• Clone: 2B9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

KLF9 Antibody (2B9) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: KLF9 (NP_001197, 25 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PEHGVAPDAERLRLPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLESPDEDMGSDSDVTT
• Specificity: KLF9 - Kruppel-like factor 9
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: KLF9
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
• Application Notes: Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for KLF9 Antibody (2B9) - Azide and BSA Free

• basic transcription element binding protein 1
• Basic transcription element-binding protein 1
• BTEB1GC-box-binding protein 1
• BTEBBTE-binding protein 1
• Krueppel-like factor 9
• Kruppel-like factor 9
• Transcription factor BTEB1

Background

The protein encoded by this gene is a transcription factor that binds to GC box elements located in the promoter. Binding of the encoded protein to a single GC box inhibits mRNA expression while binding to tandemly repeated GC box elements activates transcription.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KLF9
• Entrez:
  • 687(Human)
• OMIM:
  • 602902(Human)
• Uniprot:
  • NP_001197(Human)