KLF5 Antibody

Images

 
Western Blot: KLF5 Antibody [NBP1-88508] - Analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: KLF5 Antibody [NBP1-88508] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: KLF5 Antibody [NBP1-88508] - Staining of human stomach shows moderate nuclear and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: KLF5 Antibody [NBP1-88508] - Staining of human testis shows strong nuclear positivity in seminiferus tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KLF5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TYTMPSQFLPQQATYFPPSPPSSEPGSPDRQAEMLQNLTPPPSYAATIASKLAIHNPNLPTTLPVNSQNIQPVRYNRRSNPDLEKRRIHYCDYPGCTK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KLF5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KLF5 Protein (NBP1-88508PEP)
Publications
Read Publication using
NBP1-88508 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26212907)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KLF5 Antibody

  • Basic transcription element-binding protein 2
  • BTEB2
  • BTE-binding protein 2
  • CKLFGC-box-binding protein 2
  • Colon krueppel-like factor
  • colon kruppel-like factor
  • GC box binding protein 2
  • IKLFbasic transcription element binding protein 2
  • Intestinal-enriched krueppel-like factor
  • intestinal-enriched kruppel-like factor
  • KLF5
  • Krueppel-like factor 5
  • Kruppel-like factor 5 (intestinal)
  • Transcription factor BTEB2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3158
Species: Mu
Applications: WB, ChIP, ICC
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NB100-1051
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-Fr, PEP-ELISA
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-46179
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP2-45511
Species: Hu
Applications: WB, IHC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
221-AA
Species: Hu
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-37380
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP1-88508
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for KLF5 Antibody (NBP1-88508)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: ICC/IF, IHC-P.


Filter By Application
ICC/IF
(1)
IHC-P
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for KLF5 Antibody (NBP1-88508) (0)

There are no reviews for KLF5 Antibody (NBP1-88508). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for KLF5 Antibody (NBP1-88508) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KLF5 Products

Bioinformatics Tool for KLF5 Antibody (NBP1-88508)

Discover related pathways, diseases and genes to KLF5 Antibody (NBP1-88508). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLF5 Antibody (NBP1-88508)

Discover more about diseases related to KLF5 Antibody (NBP1-88508).
 

Pathways for KLF5 Antibody (NBP1-88508)

View related products by pathway.

PTMs for KLF5 Antibody (NBP1-88508)

Learn more about PTMs related to KLF5 Antibody (NBP1-88508).
 

Research Areas for KLF5 Antibody (NBP1-88508)

Find related products by research area.

Blogs on KLF5.

KLF4 as a transcription factor in stem cell differentiation
Kru¨ppel-like factors (KLFs) are evolutionarily conserved zinc finger transcription factors that play a role in cell differentiation, proliferation, and pluripotency. KLF4 has specifically been tied to many diverse cellular processes, including sel...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KLF5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KLF5
Entrez