KIR2.3 Antibody - BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 316-445 of human KIR2.3 (NP_690607.1). HRFEPVVFEEKSHYKVDYSRFHKTYEVAGTPCCSARELQESKITVLPAPPPPPSAFCYENELALMSQEEEEMEEEAAAAAAVAAGLGLEAGSKEEAGIIRMLEFGSHLDLERMQASLPLDNISYRRESAI |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
KCNJ4 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500 - 1:2000
|
| Theoretical MW |
49 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for KIR2.3 Antibody - BSA Free
Background
The KIR2.3 (KCNJ4) gene codes for protein that is 445 amino acid long inward rectifier potassium channel that regulates channel flow critical for electrical signaling of the nervous system, allowing for muscle excitability and neural firing. The KCNJ4 has a mass of approximately 49 kDA. Researchers are investigating the role of the KIR2.3 gene in meniere's disease, neuronitis, hyperglycemia, and noma. This gene has been shown to interact with other genes such as LIN7B, CASK, DLG4, IL16, and DLG1 in pathways such as potassium transport (in and out), antiarrhythmic pathways, dopamine-DARPP32 feedback onto cAMP pathways, and in the cholinergic synapse.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, MiAr, WB
Species: Hu
Applications: Bind
Species: Hu
Applications: IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: Block, CyTOF-reported, Flow
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Bv, Ca, Ch, Hu, Pm, Mu, Rb, Rt, Re, Ze
Applications: COMET, CyTOF-reported, Dual ISH-IHC, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Single-Cell Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ChIP, CyTOF-ready, ICC, ICFlow, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Publications for KIR2.3 Antibody (NBP3-03674) (0)
There are no publications for KIR2.3 Antibody (NBP3-03674).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for KIR2.3 Antibody (NBP3-03674) (0)
There are no reviews for KIR2.3 Antibody (NBP3-03674).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for KIR2.3 Antibody (NBP3-03674) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional KIR2.3 Products
Research Areas for KIR2.3 Antibody (NBP3-03674)
Find related products by research area.
|
Blogs on KIR2.3