kinectin Antibody

Images

 
Immunohistochemistry: kinectin Antibody [NBP1-90635] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

kinectin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ELKRLEAMLKERESDLSSKTQLLQDVQDENKLFKSQIEQLKQQNYQQASSFPPHEELLKVISEREKEISGLWNELDSLKDAVEHQRKKNNERQQQVEAVELEAKE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KTN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
kinectin Protein (NBP1-90635PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for kinectin Antibody

  • kinectin 1 (kinesin receptor)
  • kinectin
  • MGC133337

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86113
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-49881
Species: Mu, Rt
Applications: WB, PEP-ELISA
NBP1-80967
Species: Hu
Applications: ICC/IF, IHC, IHC-P, ICC
NB100-1059
Species: Hu, Ca
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33498
Species: Hu
Applications: IHC, IHC-P
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
8090-ZN
Species: Hu
AF482
Species: Mu
Applications: WB, IHC
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-01345
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-624
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for kinectin Antibody (NBP1-90635) (0)

There are no publications for kinectin Antibody (NBP1-90635).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for kinectin Antibody (NBP1-90635) (0)

There are no reviews for kinectin Antibody (NBP1-90635). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for kinectin Antibody (NBP1-90635) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional kinectin Products

Bioinformatics Tool for kinectin Antibody (NBP1-90635)

Discover related pathways, diseases and genes to kinectin Antibody (NBP1-90635). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for kinectin Antibody (NBP1-90635)

Discover more about diseases related to kinectin Antibody (NBP1-90635).
 

Pathways for kinectin Antibody (NBP1-90635)

View related products by pathway.

PTMs for kinectin Antibody (NBP1-90635)

Learn more about PTMs related to kinectin Antibody (NBP1-90635).

Blogs on kinectin

There are no specific blogs for kinectin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our kinectin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KTN1