![Immunohistochemistry-Paraffin: kinectin Antibody [NBP1-90634] - Staining in human testis and bone marrow tissues using anti-KTN1 antibody. Corresponding KTN1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/kinectin-Antibody-Immunohistochemistry-Paraffin-NBP1-90634-img0012.jpg "Immunohistochemistry-Paraffin: kinectin Antibody [NBP1-90634] - Staining in human testis and bone marrow tissues using anti-KTN1 antibody. Corresponding KTN1 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ETLMVPSKRQEALPLHQETKQESGSGKKKASSKKQKTENVFVDEPLIHATTYIPLMDNADSSPVVDKREVIDLLKPDQVEGIQKSGTKKLKTETDKENAEVKFKDFLLSLKTMMFSEDEALCVVDLLKEKSGVIQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | KTN1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-90634 | Applications | Species |
|---|---|---|
| Stadler C, Hjelmare M, Neumann B et al. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. J Proteomics 2012-04-03 [PMID: 22361696] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | KTN1 |
![Immunohistochemistry-Paraffin: kinectin Antibody [NBP1-90634] - Staining of human cerebral cortex, lymph node, skin and testis using Anti-KTN1 antibody NBP1-90634 (A) shows similar protein distribution across tissues to independent antibody NBP1-90635 (B).](http://images.novusbio.com/fullsize/kinectin-Antibody-Immunohistochemistry-Paraffin-NBP1-90634-img0014.jpg "Immunohistochemistry-Paraffin: kinectin Antibody [NBP1-90634] - Staining of human cerebral cortex, lymph node, skin and testis using Anti-KTN1 antibody NBP1-90634 (A) shows similar protein distribution across tissues to independent antibody NBP1-90635 (B).")
![Western Blot: kinectin Antibody [NBP1-90634] - Analysis in human cell line RT-4.](http://images.novusbio.com/fullsize/kinectin-Antibody-Western-Blot-NBP1-90634-img0006.jpg "Western Blot: kinectin Antibody [NBP1-90634] - Analysis in human cell line RT-4.")
![Immunocytochemistry/Immunofluorescence: kinectin Antibody [NBP1-90634] - Staining of human cell line U-251 MG shows localization to endoplasmic reticulum.](http://images.novusbio.com/fullsize/kinectin-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90634-img0013.jpg "Immunocytochemistry/Immunofluorescence: kinectin Antibody [NBP1-90634] - Staining of human cell line U-251 MG shows localization to endoplasmic reticulum.")
![Immunohistochemistry-Paraffin: kinectin Antibody [NBP1-90634] - Staining of human testis using Anti-KTN1 antibody NBP1-90634.](http://images.novusbio.com/fullsize/kinectin-Antibody-Immunohistochemistry-Paraffin-NBP1-90634-img0018.jpg "Immunohistochemistry-Paraffin: kinectin Antibody [NBP1-90634] - Staining of human testis using Anti-KTN1 antibody NBP1-90634.")
![Immunohistochemistry-Paraffin: kinectin Antibody [NBP1-90634] - Staining of human bone marrow shows low expression as expected.](http://images.novusbio.com/fullsize/kinectin-Antibody-Immunohistochemistry-Paraffin-NBP1-90634-img0010.jpg "Immunohistochemistry-Paraffin: kinectin Antibody [NBP1-90634] - Staining of human bone marrow shows low expression as expected.")
![Immunohistochemistry-Paraffin: kinectin Antibody [NBP1-90634] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/kinectin-Antibody-Immunohistochemistry-Paraffin-NBP1-90634-img0011.jpg "Immunohistochemistry-Paraffin: kinectin Antibody [NBP1-90634] - Staining of human testis shows high expression.")
![Immunohistochemistry-Paraffin: kinectin Antibody [NBP1-90634] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/kinectin-Antibody-Immunohistochemistry-Paraffin-NBP1-90634-img0015.jpg "Immunohistochemistry-Paraffin: kinectin Antibody [NBP1-90634] - Staining of human cerebral cortex.")
![Immunohistochemistry-Paraffin: kinectin Antibody [NBP1-90634] - Staining of human skin.](http://images.novusbio.com/fullsize/kinectin-Antibody-Immunohistochemistry-Paraffin-NBP1-90634-img0016.jpg "Immunohistochemistry-Paraffin: kinectin Antibody [NBP1-90634] - Staining of human skin.")
![Immunohistochemistry-Paraffin: kinectin Antibody [NBP1-90634] - Staining of human lymph node.](http://images.novusbio.com/fullsize/kinectin-Antibody-Immunohistochemistry-Paraffin-NBP1-90634-img0017.jpg "Immunohistochemistry-Paraffin: kinectin Antibody [NBP1-90634] - Staining of human lymph node.")
![Immunohistochemistry Ret Antibody [Unconjugated]](https://images.novusbio.com/images2/Ret_AF482_Immunohistochemistry_10194.jpg)
![Western Blot Ret Antibody [Unconjugated]](https://images.novusbio.com/images/af482_mouse-ret-affinity-purified-polyclonal-ab-8220249503265.jpg)
![Immunohistochemistry Ret Antibody [Unconjugated]](https://images.novusbio.com/images/af482_mouse-ret-affinity-purified-polyclonal-ab-8220249505961.jpg)
![Agonist Activity CD40/TNFRSF5 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD40_AF632_Functional_Assay_15457.jpg)
![Western Blot CD40/TNFRSF5 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD40_AF632_Western_Blot_20204.jpg)
![Simple Western CD40/TNFRSF5 Antibody [Unconjugated]](https://images.novusbio.com/images2/af632_human-cd40-tnfrsf5-affinity-purified-polyclonal-ab-simple-western-58202111562.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")