KIF6 Antibody - BSA Free

Immunohistochemistry-Paraffin: KIF6 Antibody [NBP1-86767] - Staining of human tonsil shows low expression as expected.

Immunohistochemistry-Paraffin: KIF6 Antibody [NBP1-86767] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: KIF6 Antibody [NBP1-86767] - Staining in human testis and tonsil tissues using anti-KIF6 antibody. Corresponding KIF6 RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KIF6 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KIF6 Antibody - BSA Free (NBP1-86767) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NEAVLNEEINPRLVIKRLQKEIQELKDELAMVTGEQRTEALTEAELLQLEKLITSFLEDQDSDSRLEVGADMRKVHHCFHHL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KIF6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  KIF6 Protein (NBP1-86767PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for KIF6 Antibody - BSA Free

• C6orf102
• chromosome 6 open reading frame 102
• dJ1043E3.1
• dJ137F1.4
• dJ188D3.1
• DKFZp451I2418
• kinesin family member 6
• kinesin-like protein KIF6
• MGC33317

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KIF6