Recombinant Human Ki67/MKI67 GST (N-Term) Protein

Images

 
Recombinant Human Ki67/MKI67 Protein [H00004288-Q01] - A specific band was detected for Ki67/MKI67 at approximately 36.74 kDa (as indicated). 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human Ki67/MKI67 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 3157-3256 of Human Ki-67/MKI67

Source: Wheat Germ (in vitro)

Amino Acid Sequence: RSARQNESSQPKVAEESGGQKSAKVLMQNQKGKGEAGNSDSMCLRSRKTKSQPAASTLESKSVQRVTRSVKRCAENPKKAEDNVCVKKIRTRSHRDSEDI

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
MKI67
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Ki67/MKI67 GST (N-Term) Protein

  • antigen identified by monoclonal Ki-67
  • Antigen Ki67
  • antigen KI-67
  • Ki67
  • Ki-67
  • KIA
  • Marker Of Proliferation Ki-67
  • MIB-
  • MIB-1
  • MKI67
  • PPP1R105
  • Proliferation Marker Protein Ki-67
  • proliferation-related Ki-67 antigen
  • Protein Phosphatase 1
  • Regulatory Subunit 105
  • TSG126

Background

Ki67 is a nuclear protein associated with proliferation, named after its discovery in a Hodgkin's lymphoma-derived cell line by Scholzer and Gerdes at Kiel University, Germany (1). This proliferation marker is expressed during active phases of the cell cycle (late G1, S, G2 and M), whereas the protein remains undetectable in the G0 phase. Ki67 has two main isoforms with theoretical molecular weights of 319 kDa and 359 kDa. Its abundance is tightly regulated by synthesis and degradation with an estimated half-life of 60-90 min, regardless of its position in the cell cycle. Ki67 has been shown to be involved in ribosomal biogenesis, heterochromatin maintenance, and mitotic chromosome separation (2). Detection of Ki67 by immunostaining is commonly used as a proliferation marker in solid tumors, as well as certain hematological malignancies (3-5). The Ki67 index, which reports on positive Ki67 stained tumor cell nuclei, has been extensively studied as a prognostic biomarker in cancers such as breast cancer and cervical cancer. References 1. Gerdes J, Schwab U, Lemke H, Stein H. (1983) Production of a mouse monoclonal antibody reactive with a human nuclear antigen associated with cell proliferation. Int J Cancer. 31:13-20. PMID: 6339421 2. Starborg M, Gell K, Brundell E and Hoog C. (1996) The murine Ki-67 cell proliferation antigen accumulates in the nucleolar and heterochromatic regions of interphase cells and at the periphery of the mitotic chromosomes in a process essential for cell cycle progression. J Cell Sci. 109:143-153. 1996 3. Karamitopoulou E, Perentes E, Tolnay M, Probst A. (1998) Prognostic significance of MIB-1, p53, and bcl-2 immunoreactivity in meningiomas. Hum Pathol. 29(2):140-5. PMID: 9490273 4. Geyer FC, Rodrigues DN, Weigelt B and Reis-Filho JS. (2012) Molecular classification of estrogen receptor-positive/luminal breast cancers. Adv Anat Pathol. 19(1):39-53. PMID: 22156833 5. Ikenberg H, Bergeron C, Schmidt D, Griesser H, Alameda F, Angeloni C, Bogers J, Dachez R, Denton K, Hariri J, Keller T, von Knebel Doeberitz M, Neumann HH, Puig-Tintore LM, Sideri M, Rehm S, Ridder R; PALMS Study Group. (2013) Screening for cervical cancer precursors with p16/Ki-67 dual-stained cytology: results of the PALMS study. J Natl Cancer Inst. 105(20):1550-7. PMID: 24096620

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
1129-ER
Species: Hu
Applications: BA
NBP2-24695
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
AF6897
Species: Hu, Mu
Applications: IHC, Simple Western, WB
NBP2-46085
Species: Hu
Applications: IHC,  IHC-P, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
DMP900
Species: Hu
Applications: ELISA
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB

Publications for Ki67/MKI67 Partial Recombinant Protein (H00004288-Q01) (0)

There are no publications for Ki67/MKI67 Partial Recombinant Protein (H00004288-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ki67/MKI67 Partial Recombinant Protein (H00004288-Q01) (0)

There are no reviews for Ki67/MKI67 Partial Recombinant Protein (H00004288-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ki67/MKI67 Partial Recombinant Protein (H00004288-Q01). (Showing 1 - 2 of 2 FAQ).

  1. Can I know the species of GST tag of Ki67 Partial Recombinant Protein (H00004288-Q01).
    • H00004288-Q01 is human protein that was expressed in a wheat germ system.
  2. I recently purchased Ki67 Partial Recombinant Protein (H00004288-Q01) from your company. The protein will be used screening of RNA pool. It is very crucial to screen in advance against GST epitope tag protein before Ki67 screening. So I wish to buy GST Epitope tag protein with is the same as GST tag of Ki67. Please let me know the product name among the GST tag proteins in your catalog.
    • We distribute H00004288-Q01 for Abnova, a company based in Taiwan, and are not involved in the development of this product. Abnova considers the sequence of the GST tag that they use for their recombinant proteins proprietary, but we do sell a number of GST epitope tag proteins.

Additional Ki67/MKI67 Products

Research Areas for Ki67/MKI67 Partial Recombinant Protein (H00004288-Q01)

Find related products by research area.

Blogs on Ki67/MKI67.

The relationship between Ki67 and HIF-1 in cancer
Ki67, also known as MKI67, is best known as the leading marker of cellular proliferation. Ki67 is regulated by a balance between synthesis and degradation, and often carries a very short half-life.  First discovered to be located to dividing cells,...  Read full blog post.

Ki67 - an established marker for labelling proliferating cells
Ki-67/MKI67 is an antigen which is expressed during G1, S, G2, and M phases of the cell cycle (mitotically active cells), but not during G0 phase (resting cells). It is a large protein with expected molecular weight of about 395 kDa, and it has a v...  Read full blog post.

Ki67 - A Crucial Cellular Proliferation Marker
The Ki67 antigen is a prototypic cell cycle-related protein expressed by proliferating cells in all phases of the active cell cycle (G1, S, G2 and M). It is a non-histone nuclear protein originally identified in a Hodgkin's lymphoma-derived cell line....  Read full blog post.

The Ki67 Antibody in Cell Marker Studies
The MK167, or Ki67 antibody recognizes a nuclear protein encoded by the MK167 gene. Ki167 is involved with RNA transcription and essential to cellular proliferation, being expressed by proliferating cells at all stages of the active cell cycle; it is ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Ki67/MKI67 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MKI67