| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, MA, AP |
| Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 3157-3256 of Human Ki-67/MKI67 Source: Wheat Germ (in vitro) Amino Acid Sequence: RSARQNESSQPKVAEESGGQKSAKVLMQNQKGKGEAGNSDSMCLRSRKTKSQPAASTLESKSVQRVTRSVKRCAENPKKAEDNVCVKKIRTRSHRDSEDI |
| Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality | This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source | Wheat germ |
| Protein/Peptide Type | Recombinant Protein |
| Gene | MKI67 |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Theoretical MW | 36.74 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for Ki67/MKI67 Partial Recombinant Protein (H00004288-Q01)Find related products by research area.
|
|
The relationship between Ki67 and HIF-1 in cancer Ki67, also known as MKI67, is best known as the leading marker of cellular proliferation. Ki67 is regulated by a balance between synthesis and degradation, and often carries a very short half-life. First discovered to be located to dividing cells,... Read full blog post. |
|
Ki67 - an established marker for labelling proliferating cells Ki-67/MKI67 is an antigen which is expressed during G1, S, G2, and M phases of the cell cycle (mitotically active cells), but not during G0 phase (resting cells). It is a large protein with expected molecular weight of about 395 kDa, and it has a v... Read full blog post. |
|
Ki67 - A Crucial Cellular Proliferation Marker The Ki67 antigen is a prototypic cell cycle-related protein expressed by proliferating cells in all phases of the active cell cycle (G1, S, G2 and M). It is a non-histone nuclear protein originally identified in a Hodgkin's lymphoma-derived cell line.... Read full blog post. |
|
The Ki67 Antibody in Cell Marker Studies The MK167, or Ki67 antibody recognizes a nuclear protein encoded by the MK167 gene. Ki167 is involved with RNA transcription and essential to cellular proliferation, being expressed by proliferating cells at all stages of the active cell cycle; it is ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MKI67 |