KHSRP Antibody (4C10)

Images

 
Immunocytochemistry/ Immunofluorescence: KHSRP Antibody (4C10) [H00008570-M01] - Analysis of monoclonal antibody to KHSRP on HeLa cell . Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: KHSRP Antibody (4C10) [H00008570-M01] - Analysis of monoclonal antibody to KHSRP on formalin-fixed paraffin-embedded human liver. Antibody concentration 3 ug/ml.
Sandwich ELISA: KHSRP Antibody (4C10) [H00008570-M01] - Detection limit for recombinant GST tagged KHSRP is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
4C10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

KHSRP Antibody (4C10) Summary

Immunogen
KHSRP (NP_003676, 151 a.a. ~ 239 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VPDGMVGLIIGRGGEQINKIQQDSGCKVQISPDSGGLPERSVSLTGAPESVQKAKMMLDDIVSRGRGGPPGQFHDNANGGQNGTVQEIM
Specificity
KHSRP - KH-type splicing regulatory protein (FUSE binding protein 2)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
KHSRP
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for KHSRP Antibody (4C10)

  • FBP2far upstream element-binding protein 2
  • FUBP2p75
  • FUSE binding protein 2
  • FUSE-binding protein 2
  • KH type-splicing regulatory protein
  • KH-type splicing regulatory protein
  • KSRPMGC99676

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB367
Species: Ca, Hu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
210-TA
Species: Hu
Applications: BA
DBD00
Species: Hu
Applications: ELISA
DRT100
Species: Hu
Applications: ELISA
AF1056
Species: Rt
Applications: IHC, WB
DR2A00
Species: Hu
Applications: ELISA
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NB300-517
Species: Bv, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, KD, WB
MAB7745
Species: Hu
Applications: IHC, KO, Simple Western, WB
NBP2-67329
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-60655
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-94064
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00004354-M01
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
NBP1-87801
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
202-IL
Species: Hu
Applications: BA
256-GF/CF
Species: Hu
Applications: BA
267-N3/CF
Species: Hu
Applications: BA
NLS938
Species: Hu
Applications: IHC, IHC-P
7268-CT
Species: Hu
Applications: BA
H00008570-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA

Publications for KHSRP Antibody (H00008570-M01) (0)

There are no publications for KHSRP Antibody (H00008570-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KHSRP Antibody (H00008570-M01) (0)

There are no reviews for KHSRP Antibody (H00008570-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for KHSRP Antibody (H00008570-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KHSRP Products

Bioinformatics Tool for KHSRP Antibody (H00008570-M01)

Discover related pathways, diseases and genes to KHSRP Antibody (H00008570-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KHSRP Antibody (H00008570-M01)

Discover more about diseases related to KHSRP Antibody (H00008570-M01).
 

Pathways for KHSRP Antibody (H00008570-M01)

View related products by pathway.

PTMs for KHSRP Antibody (H00008570-M01)

Learn more about PTMs related to KHSRP Antibody (H00008570-M01).

Blogs on KHSRP

There are no specific blogs for KHSRP, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KHSRP Antibody (4C10) and receive a gift card or discount.

Bioinformatics

Gene Symbol KHSRP
Entrez
OMIM
Uniprot