KF1 Recombinant Protein Antigen

Images

 
There are currently no images for KF1 Protein (NBP2-31700PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

KF1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RNF103.

Source: E. coli

Amino Acid Sequence: YFEKKRRRNNNNDEVNANNLEWLSSLWDWYTSYLFHPIASFQNFPVESDWDEDPDLFLERLAFPDLWLHPLIPTDYIKNLPMWRFKCLGVQSE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RNF103
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-31700.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for KF1 Recombinant Protein Antigen

  • E3 ubiquitin-protein ligase RNF103
  • EC 6.3.2.-
  • hkf-1
  • KF-1
  • KF1ZFP103ZFP-103
  • MGC102815
  • ring finger protein 103MGC41857
  • Zfp-103
  • zinc finger protein 103 homolog (mouse)
  • Zinc finger protein 103 homolog
  • zinc finger protein expressed in cerebellum

Background

KF1 is encoded by this gene contains a RING-H2 finger, a motif known to be involved in protein-protein and protein-DNA interactions. This gene is highly expressed in normal cerebellum, but not in the cerebral cortex. The expression of the rat counterpart in the frontal cortex and hippocampus was shown to be induced by elctroconvulsive treatment (ECT) as well as chronic antidepressant treatment, suggesting that this gene may be a molecular target for ECT and antidepressants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00008458-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NBP1-82845
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
NBP1-58268
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NB100-1965
Species: Av, Bv, Ch, Dr, Gp, Hu, Mu, Po, Rb, Rt, Sh, Xp, Ze
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NB100-1558
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
H00004068-M01
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
NB100-448
Species: Ca, ChHa, Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-85537
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MPTX20
Species: Mu
Applications: ELISA
NBP1-76593
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
H00006905-B01P
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-38770
Species: Hu, Mu
Applications:  IHC-P, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
355-BM
Species: Hu, Mu, Rt
Applications: BA
NBP2-31700PEP
Species: Hu
Applications: AC

Publications for KF1 Protein (NBP2-31700PEP) (0)

There are no publications for KF1 Protein (NBP2-31700PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KF1 Protein (NBP2-31700PEP) (0)

There are no reviews for KF1 Protein (NBP2-31700PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for KF1 Protein (NBP2-31700PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KF1 Products

Array NBP2-31700PEP

Research Areas for KF1 Protein (NBP2-31700PEP)

Find related products by research area.

Blogs on KF1

There are no specific blogs for KF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our KF1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF103