KERA Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

KERA Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KERA.
  
  

  Source: E. coli

  Amino Acid Sequence: SRSVRQVYEVHDSDDWTIHDFECPMECFCPPSFPTALYCENRGLKEIPAIPSRIWYLYL

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: KERA
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84425.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for KERA Recombinant Protein Antigen

• CNA2
• KERA
• Keratocan
• KTN
• SLRR2B
• SLRR2BKeratan sulfate proteoglycan keratocan

Background

KERA is a gene that codes for a protein that helps develop and maintain corneal transparency, as it is highly expressed in the cornea, as well as contributes to the structure of the stromal matrix that has a length of 352 amino acids and a weight of approximately 40.5 kDa. Studies are being conducted on severeal diseases and disorders relating to this gene, including cornea plana congenital, acrus senilis, keratopathy, corneal dystrophy, hyperopia, and glaucoma. KERA has also been shown to have interactions with CXCL2, B3GNT7, CHST1, CHST5, and CHST6 in pathways such as the MAroteaux-Lamy syndrome, metabolic, and Sanfilippo syndrome pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: KERA