Kell Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Kell Antibody - BSA Free (NBP3-17727) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: PRPCETSVCLDLRDHYLASGNTSVAPCTDFFSFACGRAKETNNSFQELATKNKNRLRRILEVQNSWHPGSGEEKAFQFYNSCMDTLAIEAAGTGPLRQVIEELGGWRISGKWT |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
KEL |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Kell Antibody - BSA Free
Background
KELL, also known as Kell blood group glycoprotein, is a 732 amino acid protein that is 83 kDa; expressed at high levels in erythrocytes and testis (in Sertoli cells), and, at lower levels, in skeletal muscle, tonsils (in follicular dendritic cells), lymph node, spleen and appendix; links via a single disulfide bond to the XK membrane protein that carries the Kx antigen; it is a zinc endopeptidase with endothelin-3-converting enzyme activity that cleaves EDN1, EDN2 and EDN3, with a marked preference for EDN3. Disease research is currently being studied with relation to KELL and tinea corporis, fetal erythroblastosis, carbuncle, erysipelas, scabies, alloimmunization, tinea, chronic granulomatous disease, tonsillitis, pneumonia, tuberculosis, protein s deficiency, acute chest syndrome, and autoimmune hemolytic anemia. This protein involvement has been observed with relation to XK, EDN1, EDN2, EDN3, and EWSR1 in proteolysis and vasoconstriction pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: Flow, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, PLA, WB
Species: Hu
Applications: WB
Species: Bv, Ca, Ch, Hu, Mu, Pm
Applications: ICC/IF, IP, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB
Species: Hu
Applications: ELISA
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB, ICC/IF
Publications for Kell Antibody (NBP3-17727) (0)
There are no publications for Kell Antibody (NBP3-17727).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Kell Antibody (NBP3-17727) (0)
There are no reviews for Kell Antibody (NBP3-17727).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Kell Antibody (NBP3-17727) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Kell Products
Research Areas for Kell Antibody (NBP3-17727)
Find related products by research area.
|
Blogs on Kell