Kell Antibody - BSA Free

Western Blot: Kell Antibody [NBP3-17727] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10; Lane 2: RT4; Lane 3: U-251 MG; Lane 4: Human Plasma; Lane 5: Liver; Lane 6: Tonsil

Immunocytochemistry/Immunofluorescence: Kell Antibody [NBP3-17727] - Staining of human cell line HEL shows localization to nucleoplasm & plasma membrane.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Kell Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Kell Antibody - BSA Free (NBP3-17727) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PRPCETSVCLDLRDHYLASGNTSVAPCTDFFSFACGRAKETNNSFQELATKNKNRLRRILEVQNSWHPGSGEEKAFQFYNSCMDTLAIEAAGTGPLRQVIEELGGWRISGKWT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KEL
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Kell Antibody - BSA Free

• CD238 antigen
• CD238
• EC 3.4.24.-
• ECE3
• KEL
• kell blood group antigen
• kell blood group glycoprotein
• Kell blood group
• Kell blood group, metalloendopeptidase
• Kell blood group, metallo-endopeptidase
• Kell

Background

KELL, also known as Kell blood group glycoprotein, is a 732 amino acid protein that is 83 kDa; expressed at high levels in erythrocytes and testis (in Sertoli cells), and, at lower levels, in skeletal muscle, tonsils (in follicular dendritic cells), lymph node, spleen and appendix; links via a single disulfide bond to the XK membrane protein that carries the Kx antigen; it is a zinc endopeptidase with endothelin-3-converting enzyme activity that cleaves EDN1, EDN2 and EDN3, with a marked preference for EDN3. Disease research is currently being studied with relation to KELL and tinea corporis, fetal erythroblastosis, carbuncle, erysipelas, scabies, alloimmunization, tinea, chronic granulomatous disease, tonsillitis, pneumonia, tuberculosis, protein s deficiency, acute chest syndrome, and autoimmune hemolytic anemia. This protein involvement has been observed with relation to XK, EDN1, EDN2, EDN3, and EWSR1 in proteolysis and vasoconstriction pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KEL