SLC14A1 Antibody

Images

 
Immunohistochemistry: SLC14A1 Antibody [NBP2-31781] - Staining of liver cancer.
Immunohistochemistry: SLC14A1 Antibody [NBP2-31781] - Staining of human colon shows moderate cytoplasmic positivity in glandular and endothelial cells, erythrocytes were distinctly stained.
Immunohistochemistry: SLC14A1 Antibody [NBP2-31781] - Staining of liver.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC14A1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GHYNPFFPAKLVIPITTAPNISWSDLSALELLKSIPVGVGQI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC14A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC14A1 Protein (NBP2-31781PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC14A1 Antibody

  • FLJ33745
  • HsT1341
  • HUT11
  • JK
  • JKFLJ41687
  • RACH1
  • RACH2
  • SLC14A1
  • solute carrier family 14 (urea transporter), member 1 (Kidd blood group)
  • Solute carrier family 14 member 1
  • truncated urea transporter
  • urea transporter 1
  • urea transporter JK glycoprotein
  • Urea transporter, erythrocyte
  • urea transporter-B1
  • UT1
  • UT1UT-B1
  • UT-B1
  • UTE
  • UTEblood group Kidd urea transporter

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2421
Species: Hu
Applications: WB, Flow, IHC, IHC-P, PEP-ELISA
NBP2-24750
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
NBP1-69668
Species: Hu
Applications: WB
NBP2-07087
Species: Hu
NB500-525
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF3720
Species: Hu, Mu
Applications: WB, ICC
NBP1-86613
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34252
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
AF1914
Species: Hu
Applications: WB, Flow, IP
MAB1228
Species: Hu
Applications: Flow, IHC, IP, CyTOF-ready
AF2030
Species: Hu
Applications: WB, IHC
H00002316-M01
Species: Hu
Applications: WB, ELISA, IHC-P, PLA
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SLC14A1 Antibody (NBP2-31781) (0)

There are no publications for SLC14A1 Antibody (NBP2-31781).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC14A1 Antibody (NBP2-31781) (0)

There are no reviews for SLC14A1 Antibody (NBP2-31781). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC14A1 Antibody (NBP2-31781) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC14A1 Products

Bioinformatics Tool for SLC14A1 Antibody (NBP2-31781)

Discover related pathways, diseases and genes to SLC14A1 Antibody (NBP2-31781). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC14A1 Antibody (NBP2-31781)

Discover more about diseases related to SLC14A1 Antibody (NBP2-31781).
 

Pathways for SLC14A1 Antibody (NBP2-31781)

View related products by pathway.

PTMs for SLC14A1 Antibody (NBP2-31781)

Learn more about PTMs related to SLC14A1 Antibody (NBP2-31781).

Blogs on SLC14A1

There are no specific blogs for SLC14A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC14A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC14A1
Entrez
Uniprot