BCDIN3D Antibody

Images

 
Western Blot: BCDIN3D Antibody [NBP1-85857] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: BCDIN3D Antibody [NBP1-85857] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: BCDIN3D Antibody [NBP1-85857] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BCDIN3D Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EPQPWKCYRAAARRLRKLGLHDFDHFHSLAIRGDMPNQIVQILTQDHGMELICCFGNTSWDRSLLLFRAKQTIETHPIPESLIEKGKEKNRLSFQKQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BCDIN3D
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BCDIN3D Protein (NBP1-85857PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BCDIN3D Antibody

  • BCDIN3 domain containing
  • BCDIN3 domain-containing protein
  • EC 2.1.1
  • EC 2.1.1.-
  • probable methyltransferase BCDIN3D

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-41103
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-90558
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IF
NBP2-24713
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC-P
AF5394
Species: Hu, Mu
Applications: WB
NBP1-03349
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-92093
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14950
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76998
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-06520
Species: Hu, Mu
Applications: WB, IP
AF6915
Species: Hu, Mu, Rt
Applications: WB
NB110-60935
Species: Hu, Mu, Pm
Applications: WB
NBP2-14148
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76997
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
MAB6389
Species: Hu, Mu, Rt
Applications: WB
NBP1-53082
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P
NB300-517
Species: Hu, Mu, Rt, Po, Bv, Ha, Pm, Rb
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP
NBP1-85857
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for BCDIN3D Antibody (NBP1-85857) (0)

There are no publications for BCDIN3D Antibody (NBP1-85857).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BCDIN3D Antibody (NBP1-85857) (0)

There are no reviews for BCDIN3D Antibody (NBP1-85857). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BCDIN3D Antibody (NBP1-85857) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BCDIN3D Products

Bioinformatics Tool for BCDIN3D Antibody (NBP1-85857)

Discover related pathways, diseases and genes to BCDIN3D Antibody (NBP1-85857). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BCDIN3D Antibody (NBP1-85857)

Discover more about diseases related to BCDIN3D Antibody (NBP1-85857).
 

Pathways for BCDIN3D Antibody (NBP1-85857)

View related products by pathway.

PTMs for BCDIN3D Antibody (NBP1-85857)

Learn more about PTMs related to BCDIN3D Antibody (NBP1-85857).

Blogs on BCDIN3D

There are no specific blogs for BCDIN3D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BCDIN3D Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BCDIN3D