KCP Antibody

Images

 
Western Blot: KCP Antibody [NBP1-98275] - Reccomended Titration: 1.0 ug/ml Positive Control: U937 Whole Cell

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KCP Antibody Summary

Immunogen
The immunogen for this antibody is KCP - N-terminal region. Peptide sequence AHSSVLAGNSQEQWHPLREWLGRLEAAVMELREQNKDLQTRVRQLESCEC.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for KCP Antibody

  • CRIM2
  • KCP1
  • kielin/chordin-like protein
  • NET67

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF2299
Species: Mu
Applications: WB, IHC
NB100-56883
Species: Hu
Applications: IHC, IHC-P
NBP2-12553
Species: Hu
NBP2-13255
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1320
Species: Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-83581
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
H00005956-R02
Species: Hu
338-AC/CF
Species: Hu, Mu, Rt
AF2009
Species: Hu
Applications: WB, IHC
NBP1-98275
Species: Hu
Applications: WB

Publications for KCP Antibody (NBP1-98275) (0)

There are no publications for KCP Antibody (NBP1-98275).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KCP Antibody (NBP1-98275) (0)

There are no reviews for KCP Antibody (NBP1-98275). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KCP Antibody (NBP1-98275) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KCP Products

KCP NBP1-98275

Bioinformatics Tool for KCP Antibody (NBP1-98275)

Discover related pathways, diseases and genes to KCP Antibody (NBP1-98275). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCP Antibody (NBP1-98275)

Discover more about diseases related to KCP Antibody (NBP1-98275).
 

Pathways for KCP Antibody (NBP1-98275)

View related products by pathway.

PTMs for KCP Antibody (NBP1-98275)

Learn more about PTMs related to KCP Antibody (NBP1-98275).

Blogs on KCP

There are no specific blogs for KCP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BMP-4 [Unconjugated]
314-BP-010/CF
BMP-4 [Unconjugated]
314-BP-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KCP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCP
Uniprot