AGBL2 Antibody

Images

 
Western Blot: AGBL2 Antibody [NBP1-83581] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: AGBL2 Antibody [NBP1-83581] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AGBL2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LLNGSLGEKDDLIPDTLQKEKLLWPISLSSAVHRQIEAINRDFHSCLGWMQWRGLSSLQPPPPRFKDSPASAFRVAGITDSHMLSLPHLRSRQLLYDELDEVNPRLREPQELFSILSTKRPLQAPRWPIECEVIKE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AGBL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
104 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
AGBL2 Protein (NBP1-83581PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AGBL2 Antibody

  • ATP/GTP binding protein-like 2
  • ATP/GTP-binding protein-like 2
  • CCP2
  • cytosolic carboxypeptidase 2
  • EC 3.4.17
  • EC 3.4.17.-
  • FLJ23598

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46502
Species: Hu
Applications: WB, IHC
NBP1-86568
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
31310002
Species: Hu
Applications: WB, ELISA
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-88263
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-58983
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-25966
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-684
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
AF4779
Species: Hu
Applications: WB, IHC
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB4077
Species: Hu
Applications: WB, IHC
AF2009
Species: Hu
Applications: WB, IHC
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB2005
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF1807
Species: Hu
Applications: WB, IP
AF1936
Species: Hu
Applications: WB, IP

Publications for AGBL2 Antibody (NBP1-83581) (0)

There are no publications for AGBL2 Antibody (NBP1-83581).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AGBL2 Antibody (NBP1-83581) (0)

There are no reviews for AGBL2 Antibody (NBP1-83581). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AGBL2 Antibody (NBP1-83581) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AGBL2 Products

Bioinformatics Tool for AGBL2 Antibody (NBP1-83581)

Discover related pathways, diseases and genes to AGBL2 Antibody (NBP1-83581). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AGBL2 Antibody (NBP1-83581)

Discover more about diseases related to AGBL2 Antibody (NBP1-83581).

PTMs for AGBL2 Antibody (NBP1-83581)

Learn more about PTMs related to AGBL2 Antibody (NBP1-83581).

Blogs on AGBL2

There are no specific blogs for AGBL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AGBL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AGBL2
Entrez
Uniprot