KCNMB3 Antibody

Images

 
Western Blot: KCNMB3 Antibody [NBP1-83066] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: KCNMB3 Antibody [NBP1-83066] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KCNMB3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TCTAIHTDIMDDWLDCAFTCGVHCHGQGKYPCLQVFVNLSHPGQKALLHYNEEAVQINPKCFYTPKCHQDRNDLLNSALDIKEFFDHKNGTPFSCFYSPASQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCNMB3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KCNMB3 Protein (NBP1-83066PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KCNMB3 Antibody

  • BK channel subunit beta-3
  • BKbeta3
  • Hbeta3
  • KCNMB2
  • KCNMBL
  • potassium large conductance calcium-activated channel, subfamily M beta member3
  • slo-beta-3
  • subfamily M subunit beta-3
  • voltage and Ca2+ activated potassium channel Maxi K beta 3subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33726
Species: Hu
Applications: IHC, IHC-P
NB300-535
Species: Hu, Mu, Rt, Po, Ca, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56583
Species: Hu
Applications: ICC/IF
NBP1-85823
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
AF1177
Species: Hu, Mu
Applications: WB, Simple Western, IHC
NBP1-85585
Species: Hu
Applications: ICC/IF, IHC, IHC-P
28100002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00006464-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, PLA
NBP2-20866
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP2-24582
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
AF4940
Species: Hu, Mu
Applications: ICC
MAB197
Species: Hu
Applications: Flow, CyTOF-reported, ICC, Neut
AF432
Species: Mu
Applications: WB, Flow, CyTOF-ready, ICC

Publications for KCNMB3 Antibody (NBP1-83066) (0)

There are no publications for KCNMB3 Antibody (NBP1-83066).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KCNMB3 Antibody (NBP1-83066) (0)

There are no reviews for KCNMB3 Antibody (NBP1-83066). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KCNMB3 Antibody (NBP1-83066) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KCNMB3 Products

Bioinformatics Tool for KCNMB3 Antibody (NBP1-83066)

Discover related pathways, diseases and genes to KCNMB3 Antibody (NBP1-83066). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCNMB3 Antibody (NBP1-83066)

Discover more about diseases related to KCNMB3 Antibody (NBP1-83066).
 

Pathways for KCNMB3 Antibody (NBP1-83066)

View related products by pathway.

Blogs on KCNMB3

There are no specific blogs for KCNMB3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KCNMB3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNMB3